SitesBLAST
Comparing GFF2753 FitnessBrowser__Phaeo:GFF2753 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3e18A Crystal structure of NAD-binding protein from listeria innocua
27% identity, 70% coverage: 3:257/363 of query aligns to 5:255/348 of 3e18A
- active site: K94 (= K91), H178 (= H174)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), G13 (≠ N11), M14 (= M12), F34 (vs. gap), D35 (vs. gap), I36 (vs. gap), K40 (≠ R34), A70 (= A67), T71 (= T68), P72 (≠ Y69), N73 (≠ S70), H76 (= H73), E93 (= E90), K94 (= K91), N122 (≠ I119), W161 (= W155), R162 (≠ D156), H178 (= H174)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
26% identity, 48% coverage: 6:179/363 of query aligns to 7:181/336 of 3ec7A
- active site: K97 (= K91), H176 (= H174)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), M12 (≠ N11), I13 (≠ M12), D35 (≠ N33), I36 (≠ R34), R40 (≠ A38), T73 (≠ A67), A74 (≠ T68), S75 (≠ Y69), N76 (≠ S70), H79 (= H73), E96 (= E90), K97 (= K91), M126 (≠ I119)
Sites not aligning to the query:
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
26% identity, 69% coverage: 2:250/363 of query aligns to 2:251/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (≠ N11), M12 (= M12), D33 (≠ N33), L34 (≠ R34), T70 (≠ A67), T71 (= T68), P72 (≠ Y69), N73 (≠ S70), L75 (≠ S72), H76 (= H73), Q79 (≠ Y76), E93 (= E90), K94 (= K91), N122 (≠ I119), W161 (= W155), H179 (= H174)
Sites not aligning to the query:
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
26% identity, 69% coverage: 2:250/363 of query aligns to 2:251/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ N11), F152 (≠ L146), N154 (≠ Q148), D175 (= D170), L176 (≠ C171), H179 (= H174), E236 (= E233)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G10), F11 (≠ N11), M12 (= M12), D33 (≠ N33), L34 (≠ R34), T70 (≠ A67), T71 (= T68), P72 (≠ Y69), N73 (≠ S70), L75 (≠ S72), H76 (= H73), Q79 (≠ Y76), E93 (= E90), K94 (= K91), N122 (≠ I119), W161 (= W155), H179 (= H174)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
26% identity, 69% coverage: 2:250/363 of query aligns to 2:251/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ N11), N154 (≠ Q148), D175 (= D170), H179 (= H174), E236 (= E233)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G8), G10 (= G10), F11 (≠ N11), M12 (= M12), D33 (≠ N33), L34 (≠ R34), T70 (≠ A67), T71 (= T68), P72 (≠ Y69), N73 (≠ S70), L75 (≠ S72), H76 (= H73), Q79 (≠ Y76), E93 (= E90), K94 (= K91), N122 (≠ I119), W161 (= W155)
Sites not aligning to the query:
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
29% identity, 47% coverage: 49:219/363 of query aligns to 59:232/336 of 5a06A
- active site: K101 (= K91), Y186 (≠ H174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y59 (= Y49), I77 (≠ A67), T78 (= T68), P79 (≠ Y69), N80 (≠ S70), L82 (≠ S72), H83 (= H73), E100 (= E90), K101 (= K91), R129 (≠ I119), W168 (= W155), R169 (≠ D156), Y186 (≠ H174)
- binding sorbitol: D72 (= D62), H96 (≠ D86), K101 (= K91), R122 (= R112), R122 (= R112), L124 (= L114), F160 (≠ Q148), R169 (≠ D156), D182 (= D170), Y186 (≠ H174)
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 11, 12, 13, 14, 36, 37, 38, 41, 264
- binding sorbitol: 2, 287, 296, 299, 306, 310, 311
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
29% identity, 47% coverage: 49:219/363 of query aligns to 58:231/335 of 5a05A
- active site: K100 (= K91), Y185 (≠ H174)
- binding beta-D-glucopyranose: K100 (= K91), F159 (≠ Q148), D181 (= D170), Y185 (≠ H174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y58 (= Y49), I76 (≠ A67), T77 (= T68), P78 (≠ Y69), N79 (≠ S70), L81 (≠ S72), H82 (= H73), E99 (= E90), K100 (= K91), R128 (≠ I119), W167 (= W155), R168 (≠ D156), Y185 (≠ H174)
Sites not aligning to the query:
- binding alpha-D-glucopyranose: 259, 262
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 9, 10, 11, 12, 13, 35, 36, 37, 40, 263
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
29% identity, 47% coverage: 49:219/363 of query aligns to 58:231/335 of 5a04A
- active site: K100 (= K91), Y185 (≠ H174)
- binding beta-D-glucopyranose: K100 (= K91), F159 (≠ Q148), R168 (≠ D156), D181 (= D170), Y185 (≠ H174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y58 (= Y49), I76 (≠ A67), T77 (= T68), P78 (≠ Y69), N79 (≠ S70), L81 (≠ S72), H82 (= H73), E99 (= E90), K100 (= K91), R128 (≠ I119), W167 (= W155), R168 (≠ D156), Y185 (≠ H174)
Sites not aligning to the query:
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
29% identity, 47% coverage: 49:219/363 of query aligns to 58:231/335 of 5a03E
- active site: K100 (= K91), Y185 (≠ H174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y58 (= Y49), I76 (≠ A67), T77 (= T68), P78 (≠ Y69), N79 (≠ S70), H82 (= H73), E99 (= E90), K100 (= K91), R128 (≠ I119), W167 (= W155), R168 (≠ D156), Y185 (≠ H174)
- binding beta-D-xylopyranose: K100 (= K91), F159 (≠ Q148), R168 (≠ D156), D181 (= D170), Y185 (≠ H174), E205 (vs. gap), T207 (≠ L195), R209 (≠ L197)
- binding alpha-D-xylopyranose: H134 (≠ S125)
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 9, 10, 11, 12, 13, 35, 36, 37, 40, 263
- binding alpha-D-xylopyranose: 268, 279, 280
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
29% identity, 47% coverage: 49:219/363 of query aligns to 59:232/336 of 5a03C
- active site: K101 (= K91), Y186 (≠ H174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y59 (= Y49), I77 (≠ A67), T78 (= T68), P79 (≠ Y69), N80 (≠ S70), L82 (≠ S72), H83 (= H73), E100 (= E90), K101 (= K91), R129 (≠ I119), W168 (= W155), R169 (≠ D156), Y186 (≠ H174)
- binding beta-D-xylopyranose: K101 (= K91), F160 (≠ Q148), R169 (≠ D156), D182 (= D170), Y186 (≠ H174)
Sites not aligning to the query:
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
29% identity, 47% coverage: 49:219/363 of query aligns to 58:231/335 of 5a02A
- active site: K100 (= K91), Y185 (≠ H174)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y58 (= Y49), I76 (≠ A67), T77 (= T68), P78 (≠ Y69), L81 (≠ S72), H82 (= H73), E99 (= E90), K100 (= K91), R128 (≠ I119), W167 (= W155), R168 (≠ D156), Y185 (≠ H174)
Sites not aligning to the query:
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
34% identity, 33% coverage: 6:124/363 of query aligns to 7:133/340 of 1evjA
- active site: K100 (= K91)
- binding nicotinamide-adenine-dinucleotide: G9 (= G8), L10 (= L9), G11 (= G10), K12 (≠ N11), Y13 (≠ M12), D35 (≠ N33), L77 (≠ T68), P78 (≠ Y69), N79 (≠ S70), H82 (= H73), E99 (= E90), K100 (= K91), R128 (≠ I119)
Sites not aligning to the query:
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
34% identity, 33% coverage: 6:124/363 of query aligns to 36:162/381 of 1rydA
- active site: K129 (= K91)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (= L9), G40 (= G10), K41 (≠ N11), Y42 (≠ M12), S64 (≠ N33), G65 (≠ R34), K69 (≠ A38), Y87 (= Y49), L106 (≠ T68), P107 (≠ Y69), N108 (≠ S70), L110 (≠ S72), H111 (= H73), E128 (= E90), K129 (= K91), R157 (≠ I119)
Sites not aligning to the query:
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
34% identity, 33% coverage: 6:124/363 of query aligns to 38:164/383 of 1h6dA
- active site: K131 (= K91)
- binding glycerol: K131 (= K91)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G40 (= G8), L41 (= L9), G42 (= G10), K43 (≠ N11), Y44 (≠ M12), S66 (≠ N33), G67 (≠ R34), K71 (≠ A38), Y89 (= Y49), I107 (≠ A67), L108 (≠ T68), P109 (≠ Y69), N110 (≠ S70), H113 (= H73), E130 (= E90), K131 (= K91), R159 (≠ I119)
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
28% identity, 36% coverage: 48:178/363 of query aligns to 48:181/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (= K91), R150 (≠ Q148), W157 (= W155), F160 (≠ H158), D173 (= D170), H177 (= H174)
- binding nicotinamide-adenine-dinucleotide: D51 (= D51), Y52 (≠ F52), C67 (≠ A67), T68 (= T68), P69 (≠ Y69), H73 (= H73), E90 (= E90), K91 (= K91), P92 (= P92), Q119 (≠ I119), V159 (≠ T157), F160 (≠ H158), Q166 (= Q163)
Sites not aligning to the query:
7xreC Crystal structure of dgpa (see paper)
28% identity, 36% coverage: 48:178/363 of query aligns to 58:191/363 of 7xreC
Sites not aligning to the query:
6norA Crystal structure of gend2 from gentamicin a biosynthesis in complex with NAD (see paper)
28% identity, 56% coverage: 48:249/363 of query aligns to 61:261/349 of 6norA
Sites not aligning to the query:
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
24% identity, 51% coverage: 1:184/363 of query aligns to 2:186/339 of 4mjlD
- active site: K97 (= K91)
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: K97 (= K91), H155 (≠ L146), N157 (≠ Q148), D172 (= D170), T173 (≠ C171), H176 (= H174)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), A12 (≠ N11), M13 (= M12), D35 (≠ N33), I36 (≠ R34), V73 (≠ A67), S74 (≠ T68), H79 (= H73), E96 (= E90), K97 (= K91), M126 (≠ L120), D172 (= D170)
Sites not aligning to the query:
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: 236
- binding nicotinamide-adenine-dinucleotide: 274, 282
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
24% identity, 51% coverage: 1:184/363 of query aligns to 2:186/339 of 4mioD
- active site: K97 (= K91)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K91), H155 (≠ L146), N157 (≠ Q148), D172 (= D170), T173 (≠ C171), H176 (= H174)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A12 (≠ N11), M13 (= M12), D35 (≠ N33), I36 (≠ R34), S74 (≠ T68), A78 (≠ S72), H79 (= H73), E96 (= E90), K97 (= K91), M126 (≠ L120), D172 (= D170)
Sites not aligning to the query:
4mioA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
24% identity, 51% coverage: 1:184/363 of query aligns to 2:186/339 of 4mioA
- active site: K97 (= K91)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G10), A12 (≠ N11), M13 (= M12), D35 (≠ N33), I36 (≠ R34), S74 (≠ T68), F75 (≠ Y69), H79 (= H73), E96 (= E90), K97 (= K91)
Sites not aligning to the query:
Query Sequence
>GFF2753 FitnessBrowser__Phaeo:GFF2753
MTRVLIAGLGNMGFSHALAHHHDETAQIVGLVNRSGAAARPPLQDYPVYSDFHHALAQTK
PDLVVIATYSDSHAPYAIAAMEAGADVFVEKPLATTVADARAVTDAARRLGRKLMVGYIL
RHHPSWQRLIAEARDLGPPYVFRMNLNQQSDGPTWDTHKALMQTTSPIVDCGVHYVDVMC
QITDATPQRVHGIGLRLSDEIAEDMYNYGQFQVSFSDGSVGWYEAGWGPMMSETAYFVKD
VISPNGSVSITETDKSGSDDVDSHTAVGSLIVHRSMQGTPDRRIDLPEEPDHNALCAAEQ
THMLRVIADDLNMDRHMQDAVASLAICLAADQSIRSGAPVDLTSDLTEAEATAPASPSLP
PKT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory