SitesBLAST
Comparing GFF2757 FitnessBrowser__Marino:GFF2757 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P33164 Phthalate dioxygenase reductase; PDR; EC 1.-.-.- from Burkholderia cepacia (Pseudomonas cepacia) (see paper)
28% identity, 84% coverage: 54:355/359 of query aligns to 55:321/322 of P33164
2piaA Phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s] (see paper)
28% identity, 84% coverage: 54:355/359 of query aligns to 54:320/321 of 2piaA
- binding fe2/s2 (inorganic) cluster: S270 (≠ Y303), C272 (= C305), E273 (≠ K306), G275 (= G308), C277 (= C310), G278 (≠ S311), C280 (= C313), C308 (= C343)
- binding flavin mononucleotide: R55 (= R55), T56 (≠ S56), Y57 (= Y57), S58 (= S58), A72 (= A71), V73 (= V72), G79 (= G78), R80 (= R79), G82 (≠ S81), S83 (≠ T82), I121 (≠ S122), T124 (= T125), E223 (= E242), F225 (= F244)
Sites not aligning to the query:
7ylrA Structure of a bacteria protein
28% identity, 89% coverage: 36:355/359 of query aligns to 36:326/326 of 7ylrA
- binding fe2/s2 (inorganic) cluster: C276 (= C305), K277 (= K306), G279 (= G308), C281 (= C310), G282 (≠ S311), C284 (= C313), C314 (= C343)
- binding flavin mononucleotide: R56 (= R55), H57 (≠ S56), Y58 (= Y57), S59 (= S58), A79 (= A71), V80 (= V72), R81 (≠ K73), G86 (= G78), R87 (= R79), G89 (vs. gap), S90 (= S81), T131 (= T125), E229 (= E242), F231 (= F244), E233 (≠ P246), R278 (≠ A307)
6laaA Crystal structure of full-length cyp116b46 from tepidiphilus thermophilus (see paper)
26% identity, 84% coverage: 55:355/359 of query aligns to 487:752/753 of 6laaA
- binding fe2/s2 (inorganic) cluster: S700 (≠ Y303), C702 (= C305), E703 (≠ K306), G705 (= G308), C707 (= C310), G708 (≠ S311), C710 (= C313), C740 (= C343)
- binding flavin mononucleotide: R487 (= R55), Q488 (≠ S56), Y489 (= Y57), S490 (= S58), Q506 (≠ K73), S511 (≠ G78), R512 (= R79), G514 (vs. gap), S515 (= S81), I553 (≠ S122), E651 (vs. gap), F653 (= F241)
Sites not aligning to the query:
- active site: 177, 251, 252, 359, 360, 361
- binding carbonate ion: 90, 91, 92, 241
- binding protoporphyrin ix containing fe: 54, 91, 92, 99, 103, 249, 252, 253, 298, 351, 352, 353, 357, 359, 361
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
26% identity, 68% coverage: 4:246/359 of query aligns to 154:398/403 of 3ozwA
- binding flavin-adenine dinucleotide: R206 (= R55), Q207 (≠ S56), Y208 (= Y57), S209 (= S58), S222 (≠ A71), V223 (= V72), K224 (= K73), E226 (vs. gap), P232 (= P76), G234 (= G78), Y235 (≠ R79), V236 (≠ F80), S237 (= S81), V276 (≠ S122), T279 (= T125), V395 (≠ L243), F396 (= F244)
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: P398 (= P246)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 50
- binding protoporphyrin ix containing fe: 42, 43, 81, 85, 88, 90, 94, 95, 98, 126, 130, 133
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: 53, 56, 102
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
26% identity, 68% coverage: 4:246/359 of query aligns to 154:398/403 of 3ozvA
- binding flavin-adenine dinucleotide: R206 (= R55), Q207 (≠ S56), Y208 (= Y57), S209 (= S58), S222 (≠ A71), V223 (= V72), K224 (= K73), E226 (vs. gap), P232 (= P76), G234 (= G78), Y235 (≠ R79), V236 (≠ F80), S237 (= S81), V276 (≠ S122), T279 (= T125), F396 (= F244)
Sites not aligning to the query:
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: 24, 28, 57, 102, 106
- binding flavin-adenine dinucleotide: 44, 46, 48
- binding protoporphyrin ix containing fe: 43, 81, 84, 85, 88, 90, 94, 95, 98, 126, 130, 133
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
26% identity, 68% coverage: 4:246/359 of query aligns to 154:398/403 of 3ozuA
- binding flavin-adenine dinucleotide: R206 (= R55), Q207 (≠ S56), Y208 (= Y57), S209 (= S58), S222 (≠ A71), V223 (= V72), K224 (= K73), E226 (vs. gap), P232 (= P76), G234 (= G78), Y235 (≠ R79), V236 (≠ F80), S237 (= S81), E394 (= E242), V395 (≠ L243), G397 (≠ T245), P398 (= P246)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
- binding 1-[(2R)-2-[(2,4-dichlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole: 25, 28, 43, 56, 57, 102, 122, 125, 126
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
26% identity, 68% coverage: 4:246/359 of query aligns to 154:398/403 of P39662
Sites not aligning to the query:
- 60 A→Y: Does not affect phospholipid-binding.
- 98 V→F: Blocks phospholipid-binding.
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
26% identity, 68% coverage: 4:246/359 of query aligns to 154:398/403 of 1cqxA
- binding flavin-adenine dinucleotide: Y190 (≠ H41), R206 (= R55), Q207 (≠ S56), Y208 (= Y57), S209 (= S58), S222 (≠ A71), E226 (vs. gap), Q231 (≠ V75), P232 (= P76), G234 (= G78), Y235 (≠ R79), V236 (≠ F80), S237 (= S81), V395 (≠ L243), G397 (≠ T245), P398 (= P246)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
7s3dX Structure of photosystem i with bound ferredoxin from synechococcus sp. Pcc 7335 acclimated to far-red light (see paper)
49% identity, 25% coverage: 270:358/359 of query aligns to 4:93/97 of 7s3dX
3b2gA Leptolyngbya boryana ferredoxin (see paper)
48% identity, 25% coverage: 269:358/359 of query aligns to 4:94/98 of 3b2gA
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
27% identity, 67% coverage: 6:246/359 of query aligns to 5:237/237 of 4eh1A
- binding flavin-adenine dinucleotide: Y39 (≠ H41), R55 (= R55), Q56 (≠ S56), Y57 (= Y57), S58 (= S58), S71 (≠ A71), V72 (= V72), E75 (≠ V75), N81 (vs. gap), G83 (vs. gap), L84 (vs. gap), V85 (≠ F80), S86 (= S81), T127 (= T125), E233 (= E242), F235 (= F244)
1rfkB Crystal structure of 2fe2s ferredoxin from thermophilic cyanobacterium mastigocladus laminosus (see paper)
51% identity, 24% coverage: 269:353/359 of query aligns to 4:89/97 of 1rfkB
P0A3C7 Ferredoxin-1; Ferredoxin I from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
54% identity, 21% coverage: 284:358/359 of query aligns to 21:95/99 of P0A3C7
- R43 (≠ K306) mutation R->A,E,H: No effect on electron transfer.
- T49 (= T312) mutation to A: No effect on electron transfer.
- F66 (= F328) mutation F->A,I: 1000-fold decrease in electron transfer.
- D69 (= D332) mutation to K: Small effect on electron transfer.
- D70 (≠ Y333) mutation to K: Small effect on electron transfer.
- E95 (= E358) mutation to K: 20000-fold decrease in electron transfer.
1ewyC Anabaena pcc7119 ferredoxin:ferredoxin-NADP+-reductase complex (see paper)
54% identity, 21% coverage: 284:358/359 of query aligns to 20:94/98 of 1ewyC
- binding flavin-adenine dinucleotide: A45 (≠ V309), S64 (≠ N327)
- binding fe2/s2 (inorganic) cluster: F39 (≠ Y303), S40 (= S304), C41 (= C305), R42 (≠ K306), G44 (= G308), A45 (≠ V309), C46 (= C310), C49 (= C313), L77 (= L341), C79 (= C343)
1czpA Anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a (see paper)
54% identity, 21% coverage: 284:358/359 of query aligns to 20:94/98 of 1czpA
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
25% identity, 64% coverage: 17:246/359 of query aligns to 163:392/396 of 1gvhA
- binding flavin-adenine dinucleotide: Y188 (≠ H41), R204 (= R54), Q205 (≠ R55), Y206 (= Y57), S207 (= S58), A220 (= A71), V221 (= V72), E224 (≠ V75), G227 (= G78), Q228 (≠ R79), V229 (≠ F80), S230 (= S81), V269 (≠ S122), T272 (= T125), E388 (= E242), F390 (= F244)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 48, 50
- binding protoporphyrin ix containing fe: 43, 53, 56, 57, 60, 61, 81, 84, 85, 90, 94, 95, 127, 131, 393
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
25% identity, 64% coverage: 17:246/359 of query aligns to 163:392/396 of P24232
Sites not aligning to the query:
- 29 mutation Y->E,H: 15 to 35-fold reduction in NO dioxygenase activity.; Y→F: 30-fold reduction in NO dioxygenase activity, and 80-fold increase in the O(2) dissociation rate constant.
- 95 active site, Charge relay system
- 135 active site, Charge relay system
7y5eNN Phycobilisome 31.8 kDa linker polypeptide, phycoerythrin-associated, rod (see paper)
49% identity, 24% coverage: 274:358/359 of query aligns to 12:95/99 of 7y5eNN
P27320 Ferredoxin-1; Ferredoxin I from Synechocystis sp. (strain PCC 6803 / Kazusa) (see 3 papers)
54% identity, 19% coverage: 284:353/359 of query aligns to 19:88/97 of P27320
- C40 (= C305) binding
- C45 (= C310) binding
- C48 (= C313) binding
- C78 (= C343) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Query Sequence
>GFF2757 FitnessBrowser__Marino:GFF2757
MNKFYSLTLKEVRPETRNAVSLAFDVPEDLADKFHYQQGQHLIVRTKLDGEEVRRSYSIC
RSVNDQELRIAVKQVPGGRFSTFANEQLKPGQTLEVMPPQGHFSVDLDPEREGNYLAVAA
GSGITPILSIVKTTLETEPKSEVTLFYGNKATSSTMFRDELQDLKNEYMSRLNLVYIFTR
EEQDIDLYNGRIDHEKCDKLFDHWINAKELTAAFICGPQMMTETVRDSLLNHGMEKSRIH
FELFTPAGGVPQARKDRDPAHVDPQSISEVTVIADGRSLTFPLVRDTKSILDAGNEEGAD
LPYSCKAGVCSTCRAKVVEGEVEMDQNFALEDYEVEAGYVLSCQCYPISDKVVLDYDEM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory