SitesBLAST
Comparing GFF2757 FitnessBrowser__WCS417:GFF2757 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3o0hB Crystal structure of glutathione reductase from bartonella henselae
47% identity, 99% coverage: 2:449/452 of query aligns to 1:448/459 of 3o0hB
- active site: S13 (= S14), I37 (≠ L38), C41 (= C42), C46 (= C47), K49 (= K50), D74 (≠ E75), P75 (≠ A76), Y177 (= Y176), E181 (= E180), I314 (≠ L314), A433 (≠ G434), H435 (= H436), E440 (= E441)
- binding flavin-adenine dinucleotide: I9 (= I10), G10 (= G11), G12 (= G13), S13 (= S14), G14 (= G15), A32 (= A33), E33 (= E34), E34 (≠ S35), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), R112 (≠ H113), A113 (= A114), T139 (= T138), G140 (= G139), Y177 (= Y176), R262 (= R262), N265 (≠ M265), G301 (= G301), D302 (= D302), Q308 (= Q308), L309 (= L309), T310 (= T310)
Sites not aligning to the query:
4dnaA Crystal structure of putative glutathione reductase from sinorhizobium meliloti 1021
50% identity, 99% coverage: 2:449/452 of query aligns to 1:450/461 of 4dnaA
- active site: Y37 (≠ L38), C41 (= C42), C46 (= C47), K49 (= K50), Y178 (= Y176), E182 (= E180), A435 (≠ G434), H437 (= H436), E442 (= E441)
- binding flavin-adenine dinucleotide: I9 (= I10), G10 (= G11), G11 (≠ A12), G12 (= G13), G14 (= G15), E33 (= E34), E34 (≠ S35), G39 (= G40), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), R112 (≠ H113), A113 (= A114), V139 (≠ T138), G140 (= G139), Y178 (= Y176), R264 (= R262), G303 (= G301), D304 (= D302), Q310 (= Q308), L311 (= L309), T312 (= T310)
Sites not aligning to the query:
D0VWY5 Glutathione amide reductase; GAR; EC 1.8.1.16 from Marichromatium gracile (Chromatium gracile) (see 2 papers)
42% identity, 100% coverage: 1:450/452 of query aligns to 1:451/463 of D0VWY5
- M1 (= M1) modified: Initiator methionine, Removed
- T2 (≠ A2) binding
- Q3 (≠ Y3) binding
- H4 (≠ D4) binding
- SG 14:15 (= SG 14:15) binding
- E34 (= E34) binding
- T41 (= T41) binding
- C42 (= C42) modified: Disulfide link with 47, Redox-active
- C47 (= C47) modified: Disulfide link with 42, Redox-active
- K50 (= K50) binding ; binding
- HA 113:114 (= HA 113:114) binding
- 174:180 (vs. 174:180, 57% identical) binding
- LE 197:198 (≠ RG 197:198) binding
- V230 (≠ I230) binding
- G261 (= G261) binding
- D302 (= D302) binding
- Q308 (= Q308) binding
- QLT 308:310 (= QLT 308:310) binding
- V341 (≠ A341) binding
- H437 (= H436) active site, Proton acceptor; binding
Sites not aligning to the query:
- 2:463 modified: mature protein, Glutathione amide reductase
6n7fA 1.90 angstrom resolution crystal structure of glutathione reductase from streptococcus pyogenes in complex with fad.
44% identity, 99% coverage: 1:447/452 of query aligns to 2:451/451 of 6n7fA
- active site: C43 (= C42), C48 (= C47), K51 (= K50), Y178 (= Y176), E182 (= E180), H440 (= H436), E445 (= E441)
- binding flavin-adenine dinucleotide: I11 (= I10), G12 (= G11), G14 (= G13), S15 (= S14), A16 (≠ G15), A34 (= A33), E35 (= E34), G36 (≠ S35), K37 (≠ R36), G41 (= G40), T42 (= T41), C43 (= C42), G47 (= G46), C48 (= C47), K51 (= K50), Y115 (≠ H113), A116 (= A114), T140 (= T138), G141 (= G139), Y178 (= Y176), I179 (= I177), R264 (= R262), G303 (= G301), D304 (= D302), L311 (= L309), T312 (= T310)
- binding riboflavin: G36 (≠ S35), K37 (≠ R36), Y115 (≠ H113), G270 (≠ N268)
2rabA Structure of glutathione amide reductase from chromatium gracile in complex with NAD (see paper)
42% identity, 99% coverage: 5:450/452 of query aligns to 4:447/451 of 2rabA
- active site: S13 (= S14), L37 (= L38), C41 (= C42), C46 (= C47), K49 (= K50), Y173 (= Y176), E177 (= E180), I310 (≠ L314), A431 (≠ G434), H433 (= H436), E438 (= E441)
- binding flavin-adenine dinucleotide: G10 (= G11), G12 (= G13), S13 (= S14), G14 (= G15), I32 (≠ A33), E33 (= E34), S34 (= S35), T40 (= T41), G45 (= G46), C46 (= C47), K49 (= K50), H110 (= H113), A111 (= A114), T135 (= T138), G136 (= G139), R258 (= R262), G297 (= G301), D298 (= D302), Q304 (= Q308), L305 (= L309), T306 (= T310)
- binding nicotinamide-adenine-dinucleotide: K49 (= K50), I169 (≠ V172), G172 (= G175), Y173 (= Y176), I174 (= I177), E177 (= E180), A193 (≠ Y196), L194 (≠ R197), E195 (≠ G198), V227 (≠ I230), V256 (≠ T260), G257 (= G261), Q304 (= Q308), V337 (≠ A341)
2r9zB Glutathione amide reductase from chromatium gracile (see paper)
42% identity, 99% coverage: 5:450/452 of query aligns to 4:449/453 of 2r9zB
- active site: S13 (= S14), L37 (= L38), C41 (= C42), C46 (= C47), K49 (= K50), G74 (≠ A76), Y174 (= Y176), E178 (= E180), I312 (≠ L314), A433 (≠ G434), H435 (= H436), E440 (= E441)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), I32 (≠ A33), E33 (= E34), S34 (= S35), G39 (= G40), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), H111 (= H113), A112 (= A114), T136 (= T138), G137 (= G139), I175 (= I177), R260 (= R262), G299 (= G301), D300 (= D302), Q306 (= Q308), L307 (= L309), T308 (= T310)
P06715 Glutathione reductase; GR; GRase; EC 1.8.1.7 from Escherichia coli (strain K12) (see paper)
46% identity, 94% coverage: 23:447/452 of query aligns to 23:450/450 of P06715
- C42 (= C42) modified: Disulfide link with 47, Redox-active
- C47 (= C47) modified: Disulfide link with 42, Redox-active
1gerB The structure of glutathione reductase from escherichia coli at 1.86 angstroms resolution: comparison with the enzyme from human erythrocytes (see paper)
46% identity, 94% coverage: 23:447/452 of query aligns to 22:449/449 of 1gerB
- active site: L37 (= L38), C41 (= C42), C46 (= C47), K49 (= K50), Y176 (= Y176), E180 (= E180), A436 (≠ G434), H438 (= H436), E443 (= E441)
- binding flavin-adenine dinucleotide: E33 (= E34), A34 (≠ S35), G39 (= G40), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), F113 (≠ H113), A114 (= A114), T138 (= T138), Y176 (= Y176), I177 (= I177), R262 (= R262), G301 (= G301), D302 (= D302), E308 (≠ Q308), L309 (= L309), T310 (= T310)
Sites not aligning to the query:
1getA Anatomy of an engineered NAD-binding site (see paper)
46% identity, 94% coverage: 23:447/452 of query aligns to 21:448/448 of 1getA
- active site: L36 (= L38), C40 (= C42), C45 (= C47), K48 (= K50), Y175 (= Y176), E179 (= E180), A435 (≠ G434), H437 (= H436), E442 (= E441)
- binding flavin-adenine dinucleotide: E32 (= E34), A33 (≠ S35), G38 (= G40), T39 (= T41), C40 (= C42), G44 (= G46), C45 (= C47), K48 (= K50), F112 (≠ H113), A113 (= A114), T137 (= T138), I176 (= I177), R261 (= R262), G300 (= G301), D301 (= D302), E307 (≠ Q308), L308 (= L309), T309 (= T310)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A173 (≠ G174), G174 (= G175), Y175 (= Y176), I176 (= I177), E179 (= E180), R196 (= R197), R202 (= R203), I259 (≠ T260), G260 (= G261), E307 (≠ Q308), L308 (= L309), V340 (≠ A341)
Sites not aligning to the query:
5vdnA 1.55 angstrom resolution crystal structure of glutathione reductase from yersinia pestis in complex with fad
46% identity, 94% coverage: 23:447/452 of query aligns to 22:449/449 of 5vdnA
- active site: L37 (= L38), C41 (= C42), C46 (= C47), K49 (= K50), Y176 (= Y176), E180 (= E180), A436 (≠ G434), H438 (= H436), E443 (= E441)
- binding beta-D-fructopyranose: K35 (≠ R36), T40 (= T41), G140 (= G140), D157 (≠ N157)
- binding flavin-adenine dinucleotide: E33 (= E34), A34 (≠ S35), G39 (= G40), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), F113 (≠ H113), A114 (= A114), T138 (= T138), G139 (= G139), Y176 (= Y176), I177 (= I177), R262 (= R262), G301 (= G301), D302 (= D302), E308 (≠ Q308), L309 (= L309), T310 (= T310)
Sites not aligning to the query:
6du7A Glutathione reductase from streptococcus pneumoniae (see paper)
45% identity, 93% coverage: 27:447/452 of query aligns to 26:448/448 of 6du7A
- active site: C41 (= C42), C46 (= C47), K49 (= K50), Y176 (= Y176), E180 (= E180), H437 (= H436), E442 (= E441)
- binding flavin-adenine dinucleotide: I32 (≠ A33), E33 (= E34), E34 (≠ S35), G39 (= G40), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), H113 (= H113), A114 (= A114), T138 (= T138), Y176 (= Y176), R261 (= R262), G300 (= G301), D301 (= D302), L308 (= L309), T309 (= T310)
Sites not aligning to the query:
1geuA Anatomy of an engineered NAD-binding site (see paper)
45% identity, 94% coverage: 23:447/452 of query aligns to 21:448/448 of 1geuA
- active site: L36 (= L38), C40 (= C42), C45 (= C47), K48 (= K50), Y175 (= Y176), E179 (= E180), A435 (≠ G434), H437 (= H436), E442 (= E441)
- binding flavin-adenine dinucleotide: E32 (= E34), A33 (≠ S35), K34 (≠ R36), G38 (= G40), T39 (= T41), C40 (= C42), G44 (= G46), C45 (= C47), K48 (= K50), F112 (≠ H113), A113 (= A114), T137 (= T138), G300 (= G301), D301 (= D302), L308 (= L309), T309 (= T310)
- binding nicotinamide-adenine-dinucleotide: Y175 (= Y176), I176 (= I177), E179 (= E180), E195 (≠ Y196), M196 (≠ R197), F197 (≠ G198), A258 (= A259), I259 (≠ T260), G260 (= G261), E307 (≠ Q308), L308 (= L309), V340 (≠ A341)
Sites not aligning to the query:
5ebkA Trypanothione reductase in complex with 6-(sec-butoxy)-2-((3- chlorophenyl)thio)pyrimidin-4-amine (see paper)
43% identity, 99% coverage: 1:449/452 of query aligns to 1:474/486 of 5ebkA
- active site: L48 (= L38), C52 (= C42), C57 (= C47), K60 (= K50), Y198 (= Y176), E202 (= E180), G459 (= G434), H461 (= H436), E466 (= E441)
- binding flavin-adenine dinucleotide: G11 (= G11), G13 (= G13), S14 (= S14), D35 (≠ E34), V36 (≠ S35), A46 (vs. gap), A47 (vs. gap), G50 (= G40), T51 (= T41), C52 (= C42), G56 (= G46), K60 (= K50), G127 (≠ A114), A159 (= A137), T160 (= T138), G161 (= G139), S178 (= S156), Y198 (= Y176), R287 (= R262), R290 (≠ M265), G326 (= G301), D327 (= D302), M333 (≠ Q308), L334 (= L309), T335 (= T310), A338 (= A313)
- binding 6-sec-Butoxy-2-[(3-chlorophenyl)sulfanyl]-4-pyrimidinamine: C52 (= C42), V53 (= V43), Y110 (= Y98), Y221 (= Y196), R222 (= R197), R222 (= R197), D224 (= D199), R228 (= R203), N252 (= N227), N254 (≠ D229), I285 (≠ T260), H461 (= H436), E466 (= E441)
Sites not aligning to the query:
6i7nB Trypanothione reductase from leismania infantum in complex with trl156 (see paper)
43% identity, 99% coverage: 1:449/452 of query aligns to 1:474/488 of 6i7nB
- active site: C52 (= C42), C57 (= C47), K60 (= K50), Y198 (= Y176), E202 (= E180), H461 (= H436), E466 (= E441)
- binding flavin-adenine dinucleotide: G11 (= G11), G15 (= G15), D35 (≠ E34), A46 (vs. gap), A47 (vs. gap), G50 (= G40), T51 (= T41), C52 (= C42), G56 (= G46), C57 (= C47), K60 (= K50), G127 (≠ A114), A159 (= A137), T160 (= T138), G161 (= G139), Y198 (= Y176), R287 (= R262), G326 (= G301), D327 (= D302), M333 (≠ Q308), L334 (= L309), T335 (= T310)
- binding ~{N}-(4-azanylbutyl)-~{N}-(2-azanyl-2-oxidanylidene-ethyl)-7-(3-azanyl-3-oxidanylidene-propyl)-4-(dimethylamino)-2-(2-naphthalen-2-ylethylamino)pyrrolo[2,3-d]pyrimidine-6-carboxamide: L17 (≠ V17), E18 (≠ R18), Y110 (= Y98)
Sites not aligning to the query:
6er5A X-ray structure of trypanothione reductase from leishmania infantum in complex with 2-(diethylamino)ethyl 4-((3-(4-nitrophenyl)-3- oxopropyl)amino)benzoate (see paper)
43% identity, 99% coverage: 1:449/452 of query aligns to 1:474/488 of 6er5A
- active site: C52 (= C42), C57 (= C47), K60 (= K50), Y198 (= Y176), E202 (= E180), H461 (= H436), E466 (= E441)
- binding 2-(diethylamino)ethyl 4-((3-(4-nitrophenyl)-3-oxopropyl)amino)benzoate: Y221 (= Y196), R222 (= R197), R228 (= R203), I285 (≠ T260)
- binding flavin-adenine dinucleotide: G11 (= G11), G13 (= G13), G15 (= G15), V34 (≠ A33), D35 (≠ E34), V36 (≠ S35), A46 (vs. gap), A47 (vs. gap), G50 (= G40), T51 (= T41), C52 (= C42), G56 (= G46), C57 (= C47), K60 (= K50), G127 (≠ A114), T160 (= T138), Y198 (= Y176), R287 (= R262), R290 (≠ M265), G326 (= G301), D327 (= D302), M333 (≠ Q308), L334 (= L309), T335 (= T310)
Sites not aligning to the query:
4apnA Structure of tr from leishmania infantum in complex with a diarylpirrole-based inhibitor (see paper)
43% identity, 99% coverage: 1:449/452 of query aligns to 1:474/488 of 4apnA
- active site: L48 (= L38), C52 (= C42), C57 (= C47), K60 (= K50), Y198 (= Y176), E202 (= E180), G459 (= G434), H461 (= H436), E466 (= E441)
- binding flavin-adenine dinucleotide: G11 (= G11), G13 (= G13), S14 (= S14), D35 (≠ E34), A46 (vs. gap), G50 (= G40), T51 (= T41), G56 (= G46), C57 (= C47), K60 (= K50), G127 (≠ A114), T160 (= T138), R287 (= R262), R290 (≠ M265), G326 (= G301), D327 (= D302), L334 (= L309), T335 (= T310)
- binding 4-[[1-(4-ethylphenyl)-2-methyl-5-(4-methylsulfanylphenyl)pyrrol-3-yl]methyl]thiomorpholine: L17 (≠ V17), E18 (≠ R18), S109 (≠ I97), Y110 (= Y98), M113 (≠ L101), F396 (= F372), T397 (≠ R373)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G196 (= G174), G197 (= G175), Y198 (= Y176), I199 (= I177), E202 (= E180), Y221 (= Y196), R222 (= R197), R228 (= R203), A284 (= A259), I285 (≠ T260), G286 (= G261), R287 (= R262), M333 (≠ Q308), A365 (= A341)
Sites not aligning to the query:
4adwA Crystal structure of leishmania infantum trypanothione reductase in complex with NADPH and trypanothione (see paper)
43% identity, 99% coverage: 1:449/452 of query aligns to 1:474/488 of 4adwA
- active site: L48 (= L38), C52 (= C42), C57 (= C47), K60 (= K50), Y198 (= Y176), E202 (= E180), G459 (= G434), H461 (= H436), E466 (= E441)
- binding flavin-adenine dinucleotide: G11 (= G11), G13 (= G13), S14 (= S14), G15 (= G15), D35 (≠ E34), A46 (vs. gap), G50 (= G40), T51 (= T41), C52 (= C42), G56 (= G46), C57 (= C47), K60 (= K50), G127 (≠ A114), A159 (= A137), T160 (= T138), R287 (= R262), R290 (≠ M265), G326 (= G301), D327 (= D302), M333 (≠ Q308), L334 (= L309), T335 (= T310), H461 (= H436), P462 (= P437)
- binding bis(gamma-glutamyl-cysteinyl-glycinyl)spermidine: F396 (= F372), L399 (≠ M375), H461 (= H436), E466 (= E441)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G196 (= G174), G197 (= G175), Y198 (= Y176), I199 (= I177), Y221 (= Y196), R222 (= R197), R228 (= R203), I285 (≠ T260), G286 (= G261), R287 (= R262), A365 (= A341)
Sites not aligning to the query:
2yauA X-ray structure of the leishmania infantum tryopanothione reductase in complex with auranofin (see paper)
43% identity, 99% coverage: 1:449/452 of query aligns to 1:474/488 of 2yauA
- active site: L48 (= L38), C52 (= C42), C57 (= C47), K60 (= K50), Y198 (= Y176), E202 (= E180), G459 (= G434), H461 (= H436), E466 (= E441)
- binding gold ion: C52 (= C42), C57 (= C47), T335 (= T310)
- binding flavin-adenine dinucleotide: G11 (= G11), G13 (= G13), G15 (= G15), D35 (≠ E34), V36 (≠ S35), A46 (vs. gap), A47 (vs. gap), G50 (= G40), T51 (= T41), C52 (= C42), G56 (= G46), C57 (= C47), K60 (= K50), F126 (≠ H113), G127 (≠ A114), A159 (= A137), T160 (= T138), R287 (= R262), R290 (≠ M265), D327 (= D302), L334 (= L309), T335 (= T310)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G196 (= G174), G197 (= G175), Y198 (= Y176), I199 (= I177), E202 (= E180), Y221 (= Y196), R222 (= R197), R228 (= R203), I285 (≠ T260), G286 (= G261), R287 (= R262), M333 (≠ Q308), A365 (= A341)
- binding 2,3,4,6-tetra-O-acetyl-1-thio-beta-D-glucopyranose: F396 (= F372), L399 (≠ M375), H461 (= H436)
Sites not aligning to the query:
6t98A Trypanothione reductase from leishmania infantum in complex with 9a (see paper)
43% identity, 99% coverage: 1:449/452 of query aligns to 2:475/489 of 6t98A
- active site: C53 (= C42), C58 (= C47), K61 (= K50), Y199 (= Y176), E203 (= E180), H462 (= H436), E467 (= E441)
- binding flavin-adenine dinucleotide: G12 (= G11), G14 (= G13), S15 (= S14), G16 (= G15), V35 (≠ A33), D36 (≠ E34), A47 (vs. gap), G51 (= G40), T52 (= T41), C53 (= C42), G57 (= G46), C58 (= C47), K61 (= K50), G128 (≠ A114), T161 (= T138), Y199 (= Y176), I200 (= I177), R288 (= R262), R291 (≠ M265), G327 (= G301), D328 (= D302), M334 (≠ Q308), L335 (= L309), T336 (= T310)
- binding 4-[3-methyl-1-[4-[4-(2-phenylethyl)-1,3-thiazol-2-yl]-3-(2-piperidin-4-ylethoxy)phenyl]-1,2,3-triazol-3-ium-4-yl]butan-1-amine: W22 (≠ R21), S106 (≠ R93), S110 (≠ I97), M114 (≠ L101), D117 (≠ N104)
Sites not aligning to the query:
6t97A Trypanothione reductase from leismania infantum in complex with trl190
43% identity, 99% coverage: 1:449/452 of query aligns to 2:475/489 of 6t97A
- active site: C53 (= C42), C58 (= C47), K61 (= K50), Y199 (= Y176), E203 (= E180), H462 (= H436), E467 (= E441)
- binding flavin-adenine dinucleotide: G12 (= G11), G14 (= G13), S15 (= S14), G16 (= G15), V35 (≠ A33), D36 (≠ E34), A47 (vs. gap), A48 (vs. gap), T52 (= T41), C53 (= C42), G57 (= G46), C58 (= C47), K61 (= K50), G128 (≠ A114), T161 (= T138), G162 (= G139), Y199 (= Y176), I200 (= I177), R288 (= R262), R291 (≠ M265), G327 (= G301), D328 (= D302), M334 (≠ Q308), L335 (= L309), T336 (= T310)
- binding 4-[1-[4-[4-(2-phenylethyl)-1,3-thiazol-2-yl]-3-(2-piperidin-4-ylethoxy)phenyl]-1,2,3-triazol-4-yl]butan-1-amine: E19 (≠ R18), W22 (≠ R21), S106 (≠ R93), S110 (≠ I97), Y111 (= Y98), M114 (≠ L101), D117 (≠ N104)
Sites not aligning to the query:
Query Sequence
>GFF2757 FitnessBrowser__WCS417:GFF2757
MAYDFDLYVIGAGSGGVRAARFAAGFGAKVAVAESRYLGGTCVNVGCVPKKLLVYGAHFA
EDFEQASGFGWSLGEANFDWATLIANKDREINRLNGIYRNLLVNSGVTLHEGHARLVDAH
QVEINGERFTAKHVLIATGGWPQIPEIPGHEHAIGSNEAFFLKELPKRVLVVGGGYIAVE
FAGIFHGLGAQTTLLYRGDLFLRGFDGSVRTHLKEELTKRGLDLQFNADIERIDKQADGS
LKATLKDGRVLEADCVFYATGRRPMLDNLGLENTGVKLDKRGFIEVDDQYQTADASILAI
GDVIGRVQLTPVALAEGMAVARRLFKPEQYRPVDYAMIPTAVFSLPNIGTVGLTEEEAKE
KGHKVQIFESRFRPMKLTLTECQEKTLMKLVVDADTDQVLGCHMVGPDAGEIVQGLAIAL
KAGATKQHFDDTIGVHPTAAEEFVTMRTPVAD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory