Comparing GFF2759 FitnessBrowser__Phaeo:GFF2759 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
45% identity, 99% coverage: 1:321/323 of query aligns to 7:312/312 of 4wjmA
7fcaD Pfkb(mycobacterium marinum) (see paper)
34% identity, 96% coverage: 3:313/323 of query aligns to 5:282/282 of 7fcaD
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
27% identity, 84% coverage: 1:272/323 of query aligns to 1:253/302 of 3gbuA
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
27% identity, 84% coverage: 1:272/323 of query aligns to 2:254/304 of 3ih0A
Sites not aligning to the query:
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
27% identity, 84% coverage: 2:271/323 of query aligns to 4:256/306 of 5eynA
Sites not aligning to the query:
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
27% identity, 84% coverage: 2:271/323 of query aligns to 8:260/310 of 5yggA
Sites not aligning to the query:
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
30% identity, 97% coverage: 2:313/323 of query aligns to 5:303/322 of 3lkiB
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
29% identity, 89% coverage: 36:321/323 of query aligns to 31:297/300 of 1v1bA
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
29% identity, 89% coverage: 36:321/323 of query aligns to 31:297/301 of 1v1aA
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
29% identity, 89% coverage: 36:321/323 of query aligns to 31:297/309 of Q53W83
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
25% identity, 94% coverage: 6:309/323 of query aligns to 11:319/319 of Q8ZKR2
8cqxA Ribokinase from t.Sp mutant a92g
29% identity, 99% coverage: 1:321/323 of query aligns to 1:294/300 of 8cqxA
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
25% identity, 87% coverage: 6:287/323 of query aligns to 7:264/297 of 1tz6A
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
25% identity, 87% coverage: 6:287/323 of query aligns to 7:264/299 of 1tz3A
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
35% identity, 34% coverage: 211:319/323 of query aligns to 205:301/313 of 6ilsB
Sites not aligning to the query:
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 34% coverage: 211:319/323 of query aligns to 271:367/379 of A1A6H3
Sites not aligning to the query:
>GFF2759 FitnessBrowser__Phaeo:GFF2759
MILCCGEALIDMIPAPVAGAVPVVDGADAQTGFVPHCGGAVFNTAIALGRLGQTTGLFTG
LSRDLFGQQLAAALVASHVDHGFAERSDQPSTLAFVHLRDGHAEYHFFDENSAGASLRPD
RLPELSADVDALFFGGISLCNGAAAETYAALAARERGRRIIMIDPNVRAGFAKDEAAYRS
RLAAMVARAGIVKVSDEDLHWIYPGDAPIEEKIRQILTGEAGMGPGLVILTLGSKGAKGF
LRSGPTVEVPAQVAVVADTVGAGDTFNAGFMAAATEAGVLADAASGEMDPEQLRVCLGYG
ARAAAVTVSRPGANPPWRDELAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory