Comparing GFF2760 HP15_2704 branched-chain amino acid ABC transporter, ATP-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
34% identity, 95% coverage: 12:251/252 of query aligns to 12:253/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
34% identity, 95% coverage: 12:251/252 of query aligns to 12:253/253 of 1g9xB
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 95% coverage: 4:243/252 of query aligns to 2:227/241 of 4u00A
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
34% identity, 99% coverage: 3:251/252 of query aligns to 1:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
34% identity, 99% coverage: 3:251/252 of query aligns to 1:235/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
34% identity, 99% coverage: 3:251/252 of query aligns to 1:235/235 of 6mhzA
6mbnA Lptb e163q in complex with atp (see paper)
33% identity, 99% coverage: 2:251/252 of query aligns to 1:236/241 of 6mbnA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
33% identity, 94% coverage: 4:239/252 of query aligns to 1:223/240 of 4ymuJ
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
33% identity, 98% coverage: 3:250/252 of query aligns to 1:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
33% identity, 98% coverage: 3:250/252 of query aligns to 1:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
33% identity, 98% coverage: 3:249/252 of query aligns to 1:233/233 of 6b8bA
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
34% identity, 92% coverage: 1:233/252 of query aligns to 1:222/501 of P04983
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 99% coverage: 3:251/252 of query aligns to 1:235/240 of 6mjpA
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
34% identity, 96% coverage: 1:241/252 of query aligns to 1:225/285 of 4yerA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 95% coverage: 4:243/252 of query aligns to 1:232/343 of P30750
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 95% coverage: 4:243/252 of query aligns to 3:229/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 95% coverage: 4:243/252 of query aligns to 3:229/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 95% coverage: 4:243/252 of query aligns to 3:229/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 95% coverage: 4:243/252 of query aligns to 3:229/242 of 2oljA
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 95% coverage: 4:243/252 of query aligns to 2:233/344 of 3tuzC
Sites not aligning to the query:
>GFF2760 HP15_2704 branched-chain amino acid ABC transporter, ATP-binding protein
MTALVEVKGLDKAFGGVHAVEGVSFSVEAGQVYSVIGPNGAGKTTLFNLITGLYTPTKGE
ILLNGESTAKLEPNELAERGMCRTFQQMQICMNMTAIENVMLGRHLQLKSSLFTTLFRLP
SLRRNEAAARKRAAELMEYVGCGDYLDAEASAMSYGALKRLEIARALAAEPKVILLDEPA
AGLNAVETAALEDLIRKIADQGTTVMLVEHDMKLVMGISDRLLVLNYGRVLAEGTPEEIR
QNPDVIAAYLGG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory