Comparing GFF2763 FitnessBrowser__Phaeo:GFF2763 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
31% identity, 76% coverage: 32:288/338 of query aligns to 10:258/297 of 4ry9B
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
31% identity, 76% coverage: 32:288/338 of query aligns to 10:258/297 of 4ry9A
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
29% identity, 81% coverage: 26:299/338 of query aligns to 2:256/274 of 2ioyA
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
30% identity, 78% coverage: 26:288/338 of query aligns to 4:246/270 of 4zjpA
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
28% identity, 78% coverage: 26:288/338 of query aligns to 3:246/271 of 1dbpA
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
27% identity, 81% coverage: 29:302/338 of query aligns to 6:268/292 of 2fn8A
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
28% identity, 84% coverage: 28:310/338 of query aligns to 6:269/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
28% identity, 84% coverage: 28:310/338 of query aligns to 6:269/287 of 4ry0A
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
27% identity, 81% coverage: 28:301/338 of query aligns to 6:270/287 of 5dteB
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
26% identity, 92% coverage: 28:337/338 of query aligns to 4:290/290 of 4wutA
6hbdA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-galactofuranose (see paper)
28% identity, 70% coverage: 44:281/338 of query aligns to 22:250/305 of 6hbdA
Sites not aligning to the query:
6hyhA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-fucofuranose (see paper)
28% identity, 70% coverage: 44:281/338 of query aligns to 21:249/304 of 6hyhA
Sites not aligning to the query:
6hbmA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with alpha-l-arabinofuranose (see paper)
28% identity, 70% coverage: 44:281/338 of query aligns to 21:249/304 of 6hbmA
Sites not aligning to the query:
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
25% identity, 77% coverage: 28:288/338 of query aligns to 5:258/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
25% identity, 77% coverage: 28:288/338 of query aligns to 5:258/288 of 1gudA
Sites not aligning to the query:
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
27% identity, 84% coverage: 35:317/338 of query aligns to 11:285/313 of 2h3hA
Sites not aligning to the query:
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
27% identity, 76% coverage: 33:289/338 of query aligns to 17:253/284 of 7e7mC
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
25% identity, 80% coverage: 28:298/338 of query aligns to 5:268/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
25% identity, 80% coverage: 28:298/338 of query aligns to 5:268/288 of 8wl9A
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
27% identity, 84% coverage: 35:317/338 of query aligns to 11:285/305 of 3c6qC
Sites not aligning to the query:
>GFF2763 FitnessBrowser__Phaeo:GFF2763
MKKLLLGTAIGFAAMTGSAFAAEGVTACLITKTDTNPFFVKMKEGAEAKAAELGMTLKSF
AGKVDGDHETQVAAIETCIADGAKGILLTASDTSSIVPAVQQARDAGLVVIALDTPLEPI
DSADATFATDNFLAGELIGKWAAASLGDEAANAKIAMLDLAVSQPTVGVLRDQGFLQGFG
IDLGDPNKWGDETDPRIVGNDITAGNEEGGRRAMENLLAKDPMINVVYTINEPAAAGAYE
ALKSIGRENDVLIVSVDGGCPGVQNIKDGVIGATSQQYPLLMASKGIEAISAWATTGEKP
APTPGKAFFDTGVALVTDQPAEGVDSIDTAEGTNLCWG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory