Comparing GFF2766 FitnessBrowser__Marino:GFF2766 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P16115 L-lactate dehydrogenase; L-LDH; EC 1.1.1.27 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
38% identity, 100% coverage: 1:307/307 of query aligns to 1:314/319 of P16115
1a5zA Lactate dehydrogenase from thermotoga maritima (tmldh) (see paper)
38% identity, 99% coverage: 1:304/307 of query aligns to 1:311/312 of 1a5zA
P13714 L-lactate dehydrogenase; L-LDH; EC 1.1.1.27 from Bacillus subtilis (strain 168) (see paper)
36% identity, 99% coverage: 2:305/307 of query aligns to 7:318/320 of P13714
3pqdB Crystal structure of l-lactate dehydrogenase from bacillus subtilis complexed with fbp and NAD+
37% identity, 96% coverage: 2:297/307 of query aligns to 4:307/312 of 3pqdB
8ab3A Crystal structure of the lactate dehydrogenase of cyanobacterium aponinum in complex with oxamate, nadh and fbp. (see paper)
35% identity, 95% coverage: 5:296/307 of query aligns to 25:325/330 of 8ab3A
3pqdD Crystal structure of l-lactate dehydrogenase from bacillus subtilis complexed with fbp and NAD+
36% identity, 96% coverage: 2:297/307 of query aligns to 4:297/301 of 3pqdD
5kkcA L-lactate dehydrogenase from rabbit muscle with the inhibitor 6dhnad (see paper)
37% identity, 95% coverage: 2:293/307 of query aligns to 18:319/328 of 5kkcA
5nqqC Rabbit muscle l-lactate dehydrogenase in complex with nadh and oxaloacetate (see paper)
37% identity, 95% coverage: 2:293/307 of query aligns to 21:322/331 of 5nqqC
P13491 L-lactate dehydrogenase A chain; LDH-A; LDH muscle subunit; LDH-M; EC 1.1.1.27 from Oryctolagus cuniculus (Rabbit) (see paper)
37% identity, 95% coverage: 2:293/307 of query aligns to 22:323/332 of P13491
6p6uC Crystal structure of monoclinic rabbit muscle lactate dehydrogenase with four tetramers as the asymmetric unit
37% identity, 95% coverage: 2:293/307 of query aligns to 21:322/331 of 6p6uC
P04642 L-lactate dehydrogenase A chain; LDH-A; LDH muscle subunit; LDH-M; EC 1.1.1.27 from Rattus norvegicus (Rat)
36% identity, 95% coverage: 2:293/307 of query aligns to 22:323/332 of P04642
Sites not aligning to the query:
4al4A Rat ldha in complex with 2-((4-(2-((3-((2-methyl-1,3-benzothiazol-6- yl)amino)3-oxo-propyl)carbamoylamino)ethoxy) phenyl) methylpropanedioic acid (see paper)
36% identity, 95% coverage: 2:293/307 of query aligns to 20:321/330 of 4al4A
4ajoA Rat ldha in complex with 2-((4-(4-((3-((2-methyl-1,3-benzothiazol-6yl) amino)-3-oxo-propyl)amino)-4-oxo-butyl)phenyl)methyl)propanedioic acid (see paper)
36% identity, 95% coverage: 2:293/307 of query aligns to 20:321/330 of 4ajoA
4aj4A Rat ldha in complex with 4-((2-allylsulfanyl-1,3-benzothizol-6-yl) amino)-4-oxo-butanoic acid (see paper)
36% identity, 95% coverage: 2:293/307 of query aligns to 20:321/330 of 4aj4A
4ajlA Rat ldha in complex with 3-(ethylcarbamoylamino)-n-(2-methyl-1,3- benzothiazol-6-yl)propanamide (see paper)
36% identity, 95% coverage: 2:293/307 of query aligns to 18:319/328 of 4ajlA
4ajnA Rat ldha in complex with 2-((4-(2-((3-((2-methyl-1,3-benzothiazol-6- yl)amino)-3-oxo-propyl)carbamoylamino)ethyl)phenyl)methyl) propanedioic acid (see paper)
36% identity, 95% coverage: 2:293/307 of query aligns to 19:320/329 of 4ajnA
4ajiA Rat ldha in complex with 2-((3,4-dimethoxyphenyl)methyl))propanedioic acid (see paper)
36% identity, 95% coverage: 2:293/307 of query aligns to 17:318/327 of 4ajiA
4ajhA Rat ldha in complex with n-(2-methyl-1,3-benzothiazol-6-yl)-3-ureido- propanamide and 2-(4-bromophenoxy)propanedioic acid (see paper)
36% identity, 95% coverage: 2:293/307 of query aligns to 17:318/327 of 4ajhA
4ajeA Rat ldha in complex with 2-(4-bromophenoxy)propanedioic acid (see paper)
36% identity, 95% coverage: 2:293/307 of query aligns to 17:318/327 of 4ajeA
4aj2A Rat ldha in complex with 5-(2-chlorophenyl)-1h-tetrazole (see paper)
36% identity, 95% coverage: 2:293/307 of query aligns to 17:318/327 of 4aj2A
>GFF2766 FitnessBrowser__Marino:GFF2766
MKVSVIGTGNVGSTLAFVLTLKNIIDELVLVGRSKQSVLGDVLDLRHGQLFVNTPAQVTA
GTISDTAGSDVIAVCASVPTPKNMSSRLELAQGNVQLMKELMPELARMSPDCKIVMVSNP
VDVLVHYALEFGGFRPNQVIGTGTLVDSSRFRQLLAEELRIHSEDIRAYILGEHGDSQFP
AMSCADVGGETLDATPGRYALFERASRAGFEVLKHKGCTNYAVALAAAEIIECIANDSKH
TLPVSLRVDGFLGVDDVCLSLPAVVGRNGIERVLHPRLDEKEQAAFLHSANVVREVIASS
APEKEDH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory