Comparing GFF279 FitnessBrowser__psRCH2:GFF279 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
Q6FEQ3 Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
67% identity, 98% coverage: 4:374/379 of query aligns to 2:372/387 of Q6FEQ3
P45131 Homoserine O-acetyltransferase; HAT; Homoserine O-trans-acetylase; Homoserine transacetylase; HTA; EC 2.3.1.31 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
44% identity, 93% coverage: 21:371/379 of query aligns to 11:352/358 of P45131
Sites not aligning to the query:
D2Z028 L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 from Streptomyces lavendulae (see paper)
39% identity, 89% coverage: 29:366/379 of query aligns to 23:362/374 of D2Z028
5w8oB Homoserine transacetylase metx from mycobacterium hassiacum (see paper)
38% identity, 89% coverage: 24:361/379 of query aligns to 9:329/346 of 5w8oB
6puxA Homoserine transacetylase metx from mycobacterium tuberculosis (see paper)
36% identity, 89% coverage: 24:361/379 of query aligns to 19:349/366 of 6puxA
8f2lA Crystal structure of mycobacterium tuberculosis homoserine transacetylase in complex with l-homoserine (see paper)
36% identity, 89% coverage: 24:361/379 of query aligns to 18:348/367 of 8f2lA
7rytB Crystal structure of mycobacterium tuberculosis acetylated homoserine transacetylase with coenzyme a (see paper)
36% identity, 89% coverage: 24:361/379 of query aligns to 18:348/368 of 7rytB
6ioiA Crystal structure of homoserine o-acetyltransferase in complex with coa from mycobacterium smegmatis atcc 19420 (see paper)
34% identity, 89% coverage: 24:361/379 of query aligns to 19:349/366 of 6ioiA
2vatA Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a (see paper)
33% identity, 93% coverage: 24:376/379 of query aligns to 18:347/347 of 2vatA
6iohA Crystal structure of homoserine o-acetyltransferase in complex with homoserine from mycobacterium smegmatis atcc 19420 (see paper)
34% identity, 89% coverage: 24:361/379 of query aligns to 19:349/375 of 6iohA
2vavB Crystal structure of deacetylcephalosporin c acetyltransferase (dac- soak) (see paper)
33% identity, 93% coverage: 24:376/379 of query aligns to 19:349/350 of 2vavB
Q10341 Serine O-succinyltransferase; SST; EC 2.3.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
38% identity, 75% coverage: 22:307/379 of query aligns to 88:369/504 of Q10341
Sites not aligning to the query:
>GFF279 FitnessBrowser__psRCH2:GFF279
MPTAIPADSVGLVSPQIAHFAEPLTLACGRTLADYQLIYETYGELNAARSNAVLICHALS
GHHHAAGYHSEDDRKPGWWDSCIGPGKAIDTNRFFVVSLNNLGGCNGSTGPSSTNPASGK
PYGADFPVVTVEDWVHSQARLADRLGIAQWAAVVGGSLGGMQALQWTISYPERVRHCLAI
ASAPKLSAQNIAFNEVARQAILSDPEFHGGHFQEMGVIPKRGLMLARMVGHITYLSDDAM
GTKFGRGLKSEKLNYDFNSVEFQVESYLRYQGEEFSGRFDANTYLLMTKALDYFDPAAAN
DDDLAKTFEVAKADFCVMSFTTDWRFSPERSREIVDALLAARKNVCYLEIDAPQGHDAFL
IPNPRYLQAFRGYMNRIAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory