Comparing GFF2792 FitnessBrowser__Phaeo:GFF2792 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 75% coverage: 43:217/232 of query aligns to 121:295/308 of O33341
3fijA Crystal structure of a uncharacterized protein lin1909
34% identity, 94% coverage: 1:218/232 of query aligns to 1:221/224 of 3fijA
7d53A Spua mutant - h221n with glu (see paper)
34% identity, 79% coverage: 38:221/232 of query aligns to 50:245/249 of 7d53A
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
34% identity, 79% coverage: 38:221/232 of query aligns to 56:251/255 of 7d50B
7d4rB Spua native structure (see paper)
36% identity, 60% coverage: 83:221/232 of query aligns to 65:213/215 of 7d4rB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
32% identity, 67% coverage: 43:198/232 of query aligns to 59:224/254 of P76038
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
32% identity, 67% coverage: 43:198/232 of query aligns to 57:222/252 of 6vtvB
2ywcA Crystal structure of gmp synthetase from thermus thermophilus in complex with xmp
32% identity, 59% coverage: 92:228/232 of query aligns to 72:195/475 of 2ywcA
Sites not aligning to the query:
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
30% identity, 46% coverage: 93:198/232 of query aligns to 99:192/693 of P49915
Sites not aligning to the query:
>GFF2792 FitnessBrowser__Phaeo:GFF2792
MKPIIAVTVSRRSGWRIFPLMALNIWLAGGRPVRWQSNRDADLATVDAVVIGGGDDIAPT
LYNGQIMPEVRLDPDRDALEAGIVREASRQDVPLLGICRGAQMLNVARGGRLYQDAYAFY
GLENYKTVLPRKKVTITNNSTLRRILGVSELKVNALHSQSVSSLGQGLRVTGRDQSGMVQ
AIEDPGRRFAVGVQWHPEHLFYRAAHLNLFRALVAAARTKRDTPAEQMRRAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory