Comparing GFF2824 FitnessBrowser__WCS417:GFF2824 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 75% coverage: 10:209/267 of query aligns to 22:221/378 of P69874
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
31% identity, 87% coverage: 3:235/267 of query aligns to 30:262/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
31% identity, 87% coverage: 3:235/267 of query aligns to 30:262/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
33% identity, 78% coverage: 25:233/267 of query aligns to 46:260/260 of 7ahdC
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
34% identity, 74% coverage: 21:218/267 of query aligns to 22:225/375 of 2d62A
1g291 Malk (see paper)
37% identity, 70% coverage: 26:212/267 of query aligns to 24:215/372 of 1g291
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
36% identity, 71% coverage: 21:209/267 of query aligns to 21:218/232 of 1f3oA
Sites not aligning to the query:
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
36% identity, 71% coverage: 21:209/267 of query aligns to 21:218/230 of 1l2tA
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
32% identity, 71% coverage: 21:209/267 of query aligns to 17:205/384 of 8hplC
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
32% identity, 71% coverage: 21:209/267 of query aligns to 19:207/362 of 8hprD
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
32% identity, 71% coverage: 21:209/267 of query aligns to 19:207/363 of 8hprC
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 77% coverage: 21:225/267 of query aligns to 20:226/393 of P9WQI3
8g4cB Bceabs atpgs high res tm (see paper)
30% identity, 72% coverage: 3:195/267 of query aligns to 1:203/248 of 8g4cB
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
36% identity, 73% coverage: 15:209/267 of query aligns to 13:211/350 of 3fvqB
7tchB Bceab e169q variant atp-bound conformation (see paper)
29% identity, 72% coverage: 5:195/267 of query aligns to 2:202/245 of 7tchB
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 72% coverage: 21:211/267 of query aligns to 21:216/343 of P30750
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
34% identity, 73% coverage: 14:209/267 of query aligns to 10:209/240 of 4ymuJ
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 72% coverage: 21:211/267 of query aligns to 22:217/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 72% coverage: 21:211/267 of query aligns to 22:217/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 72% coverage: 21:211/267 of query aligns to 22:217/344 of 6cvlD
Sites not aligning to the query:
>GFF2824 FitnessBrowser__WCS417:GFF2824
MTHAVLSAQGICLGYASGPVLQGFDLHLQPGEVVSILGPSGVGKSSLLRVLAGLQAPQGG
SVRVLGEPLNGPHPRVAVAFQDPSLLPWLNLEKNVAFGLDFARQPHLDHDERRRRIDHAI
AAVGLEQARQQFPAQLSGGMAQRTALARCLARQPQVLLLDEPFGALDEVTRADMQHLLLK
VNREQGSAAVLITHDIDEALLLSDRILLLGNRPARTLGEWLIDLPQPREEQVEAIGALRI
DILKTLRQASRPQSNPLDLLEPVHVPG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory