Comparing GFF2829 FitnessBrowser__Phaeo:GFF2829 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
39% identity, 96% coverage: 17:439/440 of query aligns to 35:447/448 of 6io1B
Sites not aligning to the query:
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
37% identity, 95% coverage: 19:435/440 of query aligns to 31:443/447 of 5lhaA
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
37% identity, 95% coverage: 19:435/440 of query aligns to 33:445/449 of 5lh9D
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
35% identity, 95% coverage: 19:436/440 of query aligns to 32:443/451 of 6g4fA
Sites not aligning to the query:
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
35% identity, 95% coverage: 19:436/440 of query aligns to 32:443/451 of 6g4eA
Sites not aligning to the query:
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
34% identity, 98% coverage: 8:438/440 of query aligns to 27:456/460 of 5kr6B
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
35% identity, 95% coverage: 19:436/440 of query aligns to 32:443/453 of 6g4dB
Sites not aligning to the query:
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 98% coverage: 8:438/440 of query aligns to 23:452/455 of 5kr5A
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
35% identity, 95% coverage: 20:438/440 of query aligns to 36:445/450 of 6gwiB
Sites not aligning to the query:
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
33% identity, 95% coverage: 11:427/440 of query aligns to 66:480/504 of Q94CE5
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
35% identity, 95% coverage: 19:438/440 of query aligns to 33:438/443 of 6fyqA
Sites not aligning to the query:
4e3qA Pmp-bound form of aminotransferase crystal structure from vibrio fluvialis (see paper)
34% identity, 96% coverage: 19:439/440 of query aligns to 35:448/452 of 4e3qA
Sites not aligning to the query:
4grxC Structure of an omega-aminotransferase from paracoccus denitrificans (see paper)
33% identity, 96% coverage: 19:439/440 of query aligns to 32:445/449 of 4grxC
Sites not aligning to the query:
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
33% identity, 98% coverage: 8:438/440 of query aligns to 26:453/458 of 5kr3A
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
34% identity, 98% coverage: 8:438/440 of query aligns to 25:454/459 of 5kquC
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
33% identity, 93% coverage: 21:427/440 of query aligns to 35:436/459 of D6R3B6
6s54A Transaminase from pseudomonas fluorescens (see paper)
33% identity, 95% coverage: 18:435/440 of query aligns to 36:448/453 of 6s54A
Sites not aligning to the query:
5ghgB Transaminase w58l with smba
33% identity, 95% coverage: 19:438/440 of query aligns to 33:427/433 of 5ghgB
Sites not aligning to the query:
6zhkA Crystal structure of adenosylmethionine-8-amino-7-oxononanoate aminotransferase from methanocaldococcus jannaschii dsm 2661
32% identity, 95% coverage: 19:437/440 of query aligns to 34:435/438 of 6zhkA
Sites not aligning to the query:
3du4A Crystal structure of 7-keto-8-aminopelargonic acid bound 7,8- diaminopelargonic acid synthase in bacillus subtilis (see paper)
33% identity, 96% coverage: 18:438/440 of query aligns to 32:443/448 of 3du4A
Sites not aligning to the query:
>GFF2829 FitnessBrowser__Phaeo:GFF2829
MSHVFPRHTKADLPTAVAGDGCYLIDANGKRYLDGSGGAAVSCLGHSDAEVIAAVQEQVG
KLAFAHTGFLTSEPAEALADLLISQAPGDLHRVYFVSGGSEATEAAIKLARQYHLERGDT
TRRHVIARRQSYHGNTLGALAAGGNAWRRQQFAPLLIDISHIAPCYEYVDRGDGESRYDY
GQRVANELEAEILRLGPETVMAFMAEPVVGATSGAVPAVEGYFKRIREICDQYGVLLILD
EVMCGMGRTGHLFACEADGVAPDILCIAKGLGAGYQPIGAMLCSRQIYDAIEGGSGFFQH
GHTYIGHPVATAAGLAVVRALLDRGLVQRSAEMGETLHAALVARFGQHPHVGDLRGRGLF
RGIELVADRESKTPFDPGLGIAGKLKKAAFEAGLICYPMAGTRDGRNGDHILLAPPFILS
EDQIGEITDKLEVALDQVLP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory