Comparing GFF2831 FitnessBrowser__Phaeo:GFF2831 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
38% identity, 98% coverage: 8:463/465 of query aligns to 4:456/460 of 5kr6B
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
36% identity, 92% coverage: 37:463/465 of query aligns to 31:452/455 of 5kr5A
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
36% identity, 92% coverage: 37:463/465 of query aligns to 34:453/458 of 5kr3A
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 98% coverage: 8:465/465 of query aligns to 2:456/459 of 5kquC
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
34% identity, 99% coverage: 4:464/465 of query aligns to 2:447/448 of 6io1B
6s54A Transaminase from pseudomonas fluorescens (see paper)
35% identity, 98% coverage: 6:461/465 of query aligns to 1:449/453 of 6s54A
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
36% identity, 95% coverage: 18:460/465 of query aligns to 8:444/454 of 7ypmA
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
34% identity, 96% coverage: 15:460/465 of query aligns to 8:442/450 of 6gwiB
3gjuA Crystal structure of a putative aminotransferase (mll7127) from mesorhizobium loti maff303099 at 1.55 a resolution
34% identity, 98% coverage: 8:464/465 of query aligns to 4:457/458 of 3gjuA
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
35% identity, 95% coverage: 18:460/465 of query aligns to 8:444/455 of 7ypnD
3fcrA Crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. Tm1040 at 1.80 a resolution
32% identity, 97% coverage: 17:465/465 of query aligns to 12:458/458 of 3fcrA
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
34% identity, 92% coverage: 32:460/465 of query aligns to 22:442/451 of 6g4fA
Sites not aligning to the query:
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
34% identity, 92% coverage: 32:460/465 of query aligns to 22:442/451 of 6g4eA
Sites not aligning to the query:
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
34% identity, 92% coverage: 32:460/465 of query aligns to 22:442/453 of 6g4dB
Sites not aligning to the query:
5ghgB Transaminase w58l with smba
33% identity, 93% coverage: 31:463/465 of query aligns to 22:427/433 of 5ghgB
Sites not aligning to the query:
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
31% identity, 92% coverage: 35:460/465 of query aligns to 69:488/504 of Q94CE5
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
33% identity, 92% coverage: 38:463/465 of query aligns to 29:438/443 of 6fyqA
Sites not aligning to the query:
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
32% identity, 90% coverage: 37:454/465 of query aligns to 2:408/422 of 7qx3A
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
31% identity, 94% coverage: 17:454/465 of query aligns to 9:429/443 of 7qx0B
5ti8B Crystal structure of an aspartate aminotransferase from pseudomonas (see paper)
31% identity, 89% coverage: 37:452/465 of query aligns to 1:368/384 of 5ti8B
>GFF2831 FitnessBrowser__Phaeo:GFF2831
MDGTFNENDLSRVIAADKANVWHHLIQHKPFEENDPRIIVEGKGMRVWDQNGKEWLDAVS
GGVWTVNVGYGREEIAKAVYDQLMKLCYFAQSAGSIPGALFAEKLIEKMPGMSRVYYNNS
GSEANEKAFKMVRQIAHKKYGGKKTKILYRDRDYHGSTLAAMSAGGQEERNMQYGPFAPD
FVKVPHCMEYRKHELGLEHLSGKEFGIAAANQIEEIILREGPDTVGALCLEPVTAGGGVI
EAPEGYWPRVQEICKQYDILLHIDEVVCGVGRTGTWFGYQHYGIQPDFVTMAKGVASGYA
AIACLVTTEAVFDMFKDDASDPMNYFRDISTFGGCTAGPAAALVNMQIIEDENLLDNCTA
MGARMKSNLEALMEKHQVIGDVRGKGLFIGAELVADRDTKEPVDEKLAQAVVAECGNQNV
IIGVTNRSIPGKNNTLCFSPALIVTPEDVDKITDAVDVALTKVFG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory