Comparing GFF2832 FitnessBrowser__Phaeo:GFF2832 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
8gxkB Pseudomonas jinjuensis n-acetyltransferase (see paper)
35% identity, 95% coverage: 5:187/193 of query aligns to 3:182/188 of 8gxkB
1yreB Hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa
35% identity, 95% coverage: 4:187/193 of query aligns to 2:182/187 of 1yreB
8gxfB Pseudomonas flexibilis gcn5 family acetyltransferase (see paper)
34% identity, 95% coverage: 4:187/193 of query aligns to 2:182/187 of 8gxfB
6c37A Mycobacterium smegmatis rimj in complex with coa-disulfide
30% identity, 68% coverage: 63:193/193 of query aligns to 77:205/209 of 6c37A
Sites not aligning to the query:
6c32A Mycobacterium smegmatis rimj with accoa
30% identity, 68% coverage: 63:193/193 of query aligns to 77:205/209 of 6c32A
>GFF2832 FitnessBrowser__Phaeo:GFF2832
MWASPLPLTGKTVSLTPLLPDHASDLAEAAADGDLHRLWYTTVPAPQDIGTEINRRLALQ
DSGSMAPFAILDSTGRAVGMTTYMNIDAANRRLEIGSTWYRTSVQRSGINTECKFLLLSH
AFETLNAIAVEFRTHRLNRQSRAAIERLGAQLDGILRAHMILANGTQRDTAVYSITASEW
PTIRAHLLHLLGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory