Comparing GFF2835 FitnessBrowser__Phaeo:GFF2835 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7zlaB Cryo-em structure of holo-pdxr from bacillus clausii bound to its target DNA in the half-closed conformation (see paper)
28% identity, 96% coverage: 10:482/491 of query aligns to 2:455/458 of 7zlaB
7zn5B Cryo-em structure of holo-pdxr from bacillus clausii bound to its target DNA in the closed conformation, c2 symmetry. (see paper)
26% identity, 95% coverage: 18:482/491 of query aligns to 7:432/435 of 7zn5B
Sites not aligning to the query:
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
29% identity, 64% coverage: 173:484/491 of query aligns to 79:399/404 of 3wx9A
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
29% identity, 64% coverage: 173:484/491 of query aligns to 79:399/404 of 3av7A
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
29% identity, 64% coverage: 173:484/491 of query aligns to 79:399/404 of 3aowC
Sites not aligning to the query:
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
29% identity, 64% coverage: 173:484/491 of query aligns to 79:399/404 of 3aovA
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
29% identity, 63% coverage: 177:484/491 of query aligns to 80:397/403 of 1wstA
5t4kA Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
33% identity, 56% coverage: 122:394/491 of query aligns to 2:269/360 of 5t4kA
Sites not aligning to the query:
5t4jB Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
33% identity, 56% coverage: 122:394/491 of query aligns to 2:269/360 of 5t4jB
Sites not aligning to the query:
6uxzB (S)-4-amino-5-phenoxypentanoate as a selective agonist of the transcription factor gabr (see paper)
33% identity, 56% coverage: 122:394/491 of query aligns to 1:268/358 of 6uxzB
Sites not aligning to the query:
5x03B Crystal structure of thE C-terminal domain of bacillus subtilis gabr reveals a closed conformation by the binding of gamma-aminobutyric acid, inducing the transcriptional activation (see paper)
33% identity, 56% coverage: 122:394/491 of query aligns to 1:268/365 of 5x03B
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
28% identity, 63% coverage: 171:481/491 of query aligns to 78:399/405 of 2zc0A
7pq9AAA PLP-dependent aminotransferase family protein (see paper)
26% identity, 73% coverage: 127:482/491 of query aligns to 4:359/367 of 7pq9AAA
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
30% identity, 61% coverage: 187:484/491 of query aligns to 83:387/392 of 3cbfA
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
30% identity, 61% coverage: 187:484/491 of query aligns to 83:387/392 of 2egyA
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
30% identity, 61% coverage: 187:484/491 of query aligns to 87:391/397 of 2zyjA
Sites not aligning to the query:
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
30% identity, 61% coverage: 187:484/491 of query aligns to 87:391/397 of Q72LL6
Sites not aligning to the query:
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
30% identity, 61% coverage: 187:484/491 of query aligns to 79:383/389 of 2z1yA
Sites not aligning to the query:
4gebA Kynurenine aminotransferase ii inhibitors (see paper)
26% identity, 60% coverage: 193:486/491 of query aligns to 110:424/428 of 4gebA
Sites not aligning to the query:
4ge9A Kynurenine aminotransferase ii inhibitors (see paper)
26% identity, 60% coverage: 193:486/491 of query aligns to 110:424/428 of 4ge9A
Sites not aligning to the query:
>GFF2835 FitnessBrowser__Phaeo:GFF2835
MAISVDTFFLNPDAHGTLQAQIQEMIAEGILSGRLRVGEKLPSSRKLAAHLGISRITVTL
AYTELLANDYLISKGRSGYYVSENAPVPPSYAPSQKSADTVDWSSAIVGNYCGGDTPRKP
QDWRDYRYPFIYGQADASLFDHANWRLCALRALGQKDFAALTNDYFDQDDPLLVEYIARH
TLPRRGISARPEEILITLGAQNALWLVTQLLLGPGRKAALEDPTYYTLRDQLVYRGCEID
CLPVDHDGLPPDTIRDDTDVIFTTPSHQSPTTATMPMARRKQLLERAREIDAVIVEDDYE
FEMSFLGAPSPALKSLDADGRVVYVGSFSKSLFPGLRLGYLVGSEPFIRQARALRANVLR
HPPGHVQRTVAYFLSLGHYDAQIRRMAKVLHDRRCVIEDAVTHHGLSVAGVGVYGGSSLW
MRADEGVDTAAVAQSLKATSVLIEPGAPFFAAEHRKQNYYRLGYSSIPSNRIAPGLALIA
EALRPSRAKAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory