Comparing GFF2835 FitnessBrowser__WCS417:GFF2835 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
36% identity, 83% coverage: 23:286/317 of query aligns to 16:280/304 of 1wwkA
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
37% identity, 75% coverage: 55:291/317 of query aligns to 44:282/299 of 6rj2A
7dkmA Phgdh covalently linked to oridonin (see paper)
37% identity, 75% coverage: 55:291/317 of query aligns to 48:286/306 of 7dkmA
Sites not aligning to the query:
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
37% identity, 75% coverage: 55:291/317 of query aligns to 47:285/301 of 6rj5A
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
37% identity, 75% coverage: 55:291/317 of query aligns to 46:284/299 of 6cwaA
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
37% identity, 75% coverage: 55:291/317 of query aligns to 47:285/302 of 7ewhA
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
37% identity, 75% coverage: 55:291/317 of query aligns to 47:285/302 of 6rihA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
37% identity, 75% coverage: 55:291/317 of query aligns to 47:285/303 of 6plgA
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
37% identity, 75% coverage: 55:291/317 of query aligns to 48:286/305 of 6plfA
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
37% identity, 75% coverage: 55:291/317 of query aligns to 46:284/297 of 6rj3A
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
39% identity, 69% coverage: 72:291/317 of query aligns to 55:276/292 of 6plfB
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
37% identity, 75% coverage: 55:291/317 of query aligns to 52:290/533 of O43175
Sites not aligning to the query:
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
33% identity, 77% coverage: 43:286/317 of query aligns to 39:290/334 of 5aovA
7cvpA The crystal structure of human phgdh from biortus.
41% identity, 58% coverage: 107:291/317 of query aligns to 54:239/254 of 7cvpA
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
36% identity, 79% coverage: 55:305/317 of query aligns to 46:298/526 of 3dc2A
Sites not aligning to the query:
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
36% identity, 79% coverage: 55:305/317 of query aligns to 47:299/525 of 3ddnB
7va1A Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35
41% identity, 58% coverage: 107:291/317 of query aligns to 4:189/193 of 7va1A
6rj6A Crystal structure of phgdh in complex with bi-4924 (see paper)
41% identity, 58% coverage: 107:291/317 of query aligns to 5:190/204 of 6rj6A
5ofwA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-chloro-4-fluorobenzamide (see paper)
41% identity, 58% coverage: 107:291/317 of query aligns to 6:191/195 of 5ofwA
Sites not aligning to the query:
5ofvA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-fluoro-2-methylbenzoic acid (see paper)
41% identity, 58% coverage: 107:291/317 of query aligns to 6:191/195 of 5ofvA
Sites not aligning to the query:
>GFF2835 FitnessBrowser__WCS417:GFF2835
MSVQIAVIDDWQHVASDVVNWSVLEAVGQVHFLHDYPTDTATMIERLKGFEVICVMRERS
TFDKALLQGLPKLKLLVTGGMRNAAIDLPAARALGITVCGTDSYKHAAPELTWALIMAST
RNLLAEANALRAGHWQVGLGGDLYGKTLGVLGLGSIGQKVAKFAQVFGMRVIAWSENLTP
ERAAESGVTWVSKQALFEQADILTVHLVLSDRSRGLVDAEALGWMKPSARLVNTARGPIV
DESALVRALESGRLAGAALDVYTEEPLPVDHPFRRLPNVLATPHVGYVSEQNYRQFYAQM
IEDIQAWANGAPIRVLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory