Comparing GFF2839 FitnessBrowser__Phaeo:GFF2839 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
36% identity, 95% coverage: 14:282/283 of query aligns to 17:323/325 of 1xcoD
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
35% identity, 99% coverage: 3:282/283 of query aligns to 7:333/339 of 6ioxA
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
38% identity, 96% coverage: 11:282/283 of query aligns to 399:708/714 of Q8ZND6
Sites not aligning to the query:
6zngF Maeb full-length acetyl-coa bound state (see paper)
32% identity, 93% coverage: 17:279/283 of query aligns to 439:739/753 of 6zngF
Sites not aligning to the query:
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
31% identity, 100% coverage: 1:282/283 of query aligns to 1:326/332 of 2af3C
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
31% identity, 100% coverage: 1:282/283 of query aligns to 2:327/333 of P38503
Sites not aligning to the query:
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
28% identity, 99% coverage: 4:282/283 of query aligns to 431:753/759 of P76558
Sites not aligning to the query:
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
27% identity, 70% coverage: 83:280/283 of query aligns to 79:283/288 of 3u9eB
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
27% identity, 70% coverage: 83:280/283 of query aligns to 77:281/285 of 3uf6A
>GFF2839 FitnessBrowser__Phaeo:GFF2839
MTVLEKAYAQARNRKARVVFPEMDDPRVAAAVDQLTREGLVEAVPLAPVSAAHVEVLVAA
RGMKEGIAKRMLSKPLYRAAAMVAAGEADAMVAGADVPTRRVIEAASIGIGLDAGVSTAS
SFFLMIFPDGRELVFADCAVNVAPDAAQLADIARASTRSAEALLGAARVAMLSFSTDTSG
DGDSVALVRAAAEASGFAGPVQADAALNPAIAEKKGIAPVKANVLIFPTLDAGNIGYKLC
QELGGAQALGPFLQGFAKPVCDLSRGASVEDIVAATVLTVAQI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory