SitesBLAST
Comparing GFF2840 FitnessBrowser__Marino:GFF2840 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
47% identity, 98% coverage: 7:247/247 of query aligns to 5:246/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
47% identity, 98% coverage: 7:247/247 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G17), S138 (= S143), Q148 (= Q153), Y151 (= Y156), K155 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (= S15), R11 (= R16), I13 (= I18), N31 (= N36), Y32 (= Y37), A33 (≠ R38), G34 (≠ S39), S35 (≠ R40), A58 (= A63), N59 (≠ D64), V60 (≠ L65), N86 (= N91), A87 (= A92), T109 (= T114), S138 (= S143), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G187)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
46% identity, 99% coverage: 4:247/247 of query aligns to 3:247/247 of 4jroC
- active site: G16 (= G17), S142 (= S143), Q152 (= Q153), Y155 (= Y156), K159 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), R15 (= R16), G16 (= G17), I17 (= I18), N35 (= N36), Y36 (= Y37), N37 (≠ R38), G38 (≠ S39), S39 (≠ R40), N63 (≠ D64), V64 (≠ L65), N90 (= N91), A91 (= A92), I93 (= I94), I113 (≠ T114), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), I188 (≠ T189), T190 (= T191)
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
47% identity, 99% coverage: 3:247/247 of query aligns to 9:253/254 of 4ag3A
- active site: G23 (= G17), S148 (= S143), Y161 (= Y156), K165 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G13), S21 (= S15), R22 (= R16), G23 (= G17), I24 (= I18), T44 (≠ S39), L68 (≠ A63), D69 (= D64), V70 (≠ L65), N96 (= N91), A97 (= A92), I146 (= I141), S148 (= S143), Y161 (= Y156), K165 (= K160), P191 (= P186), G192 (= G187), F193 (= F188), I194 (≠ T189), T196 (= T191), M198 (= M193), T199 (≠ L194)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
48% identity, 99% coverage: 4:247/247 of query aligns to 3:243/244 of 6t77A
- active site: G16 (= G17), S138 (= S143), Y151 (= Y156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), R15 (= R16), T37 (≠ S39), L58 (≠ F61), N59 (≠ D64), V60 (≠ L65), A87 (= A92), G88 (= G93), I89 (= I94)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
50% identity, 99% coverage: 4:247/247 of query aligns to 3:239/240 of 4dmmB
- active site: G16 (= G17), S142 (= S143), Q152 (= Q153), Y155 (= Y156), K159 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), R15 (= R16), G16 (= G17), I17 (= I18), A37 (≠ R38), S38 (= S39), S39 (≠ R40), A62 (= A63), D63 (= D64), V64 (≠ L65), N90 (= N91), A91 (= A92), L113 (≠ T114), I140 (= I141), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), G186 (= G187), I188 (≠ T189), T190 (= T191), M192 (= M193)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
45% identity, 96% coverage: 8:245/247 of query aligns to 3:242/244 of 1edoA
- active site: G12 (= G17), S138 (= S143), Y151 (= Y156), K155 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (= S15), R11 (= R16), I13 (= I18), N31 (= N36), Y32 (= Y37), A33 (≠ R38), R34 (≠ S39), S35 (≠ R40), D59 (= D64), V60 (≠ L65), N86 (= N91), A87 (= A92), S138 (= S143), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G187), I184 (≠ T189), S186 (≠ T191), M188 (= M193)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
47% identity, 99% coverage: 3:247/247 of query aligns to 2:243/244 of P0AEK2
- GASR 12:15 (= GASR 13:16) binding
- T37 (≠ S39) binding
- NV 59:60 (≠ DL 64:65) binding
- N86 (= N91) binding
- Y151 (= Y156) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YAASK 156:160) binding
- A154 (≠ S159) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K160) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ T189) binding
- E233 (≠ Q237) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
47% identity, 99% coverage: 3:247/247 of query aligns to 1:242/243 of 1q7bA
- active site: G15 (= G17), E101 (≠ D107), S137 (= S143), Q147 (= Q153), Y150 (= Y156), K154 (= K160)
- binding calcium ion: E232 (≠ Q237), T233 (≠ Q238)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (= S15), R14 (= R16), T36 (≠ S39), N58 (≠ D64), V59 (≠ L65), N85 (= N91), A86 (= A92), G87 (= G93), I88 (= I94), S137 (= S143), Y150 (= Y156), K154 (= K160), P180 (= P186), G181 (= G187), I183 (≠ T189)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
46% identity, 99% coverage: 3:247/247 of query aligns to 1:242/243 of 1q7cA
- active site: G15 (= G17), S137 (= S143), Q147 (= Q153), F150 (≠ Y156), K154 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (= S15), R14 (= R16), A35 (≠ R38), T36 (≠ S39), L57 (≠ F61), N58 (≠ D64), V59 (≠ L65), G87 (= G93), I88 (= I94)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
47% identity, 99% coverage: 4:247/247 of query aligns to 3:243/244 of P0A2C9
- M125 (= M130) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A228) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (≠ A229) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
46% identity, 99% coverage: 3:247/247 of query aligns to 5:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (= S15), R18 (= R16), I20 (= I18), T40 (≠ S39), N62 (≠ K62), V63 (≠ A63), N89 (= N91), A90 (= A92), I92 (= I94), V139 (≠ I141), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (= P186), G185 (= G187), I187 (≠ T189), T189 (= T191), M191 (= M193)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
46% identity, 100% coverage: 1:247/247 of query aligns to 1:246/247 of P73574
- A14 (= A14) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ F151) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K160) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (= F188) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ R202) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
47% identity, 99% coverage: 4:247/247 of query aligns to 2:242/243 of 7emgB
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
46% identity, 99% coverage: 3:247/247 of query aligns to 5:242/243 of 4i08A
- active site: G19 (= G17), N113 (= N115), S141 (= S143), Q151 (= Q153), Y154 (= Y156), K158 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (= S15), R18 (= R16), I20 (= I18), T40 (≠ S39), N62 (≠ K62), V63 (≠ A63), N89 (= N91), A90 (= A92), G140 (≠ T142), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (= P186), G185 (= G187), T189 (= T191)
4bnzA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-methyl-n-phenylindole- 3-carboxamide at 2.5a resolution (see paper)
46% identity, 99% coverage: 3:247/247 of query aligns to 4:240/241 of 4bnzA
4bo4C Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2-methoxyphenyl)-3,4- dihydro-2h-quinoline-1-carboxamide at 2.7a resolution (see paper)
47% identity, 99% coverage: 3:247/247 of query aligns to 15:254/255 of 4bo4C
4nbuB Crystal structure of fabg from bacillus sp (see paper)
45% identity, 100% coverage: 1:247/247 of query aligns to 2:244/244 of 4nbuB
- active site: G18 (= G17), N111 (= N115), S139 (= S143), Q149 (= Q153), Y152 (= Y156), K156 (= K160)
- binding acetoacetyl-coenzyme a: D93 (= D97), K98 (= K102), S139 (= S143), N146 (= N150), V147 (≠ F151), Q149 (= Q153), Y152 (= Y156), F184 (= F188), M189 (= M193), K200 (≠ Q204)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ R16), G18 (= G17), I19 (= I18), D38 (≠ S42), F39 (≠ E43), V59 (≠ A63), D60 (= D64), V61 (≠ L65), N87 (= N91), A88 (= A92), G89 (= G93), I90 (= I94), T137 (≠ I141), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), F184 (= F188), T185 (= T189), T187 (= T191), M189 (= M193)
4bnyA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 4-(2-phenylthieno(3,2-d) pyrimidin-4-yl)morpholine at 1.8a resolution (see paper)
46% identity, 99% coverage: 3:247/247 of query aligns to 3:238/239 of 4bnyA
4bnxA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 6-(4-(2-chloroanilino)- 1h-quinazolin-2-ylidene)cyclohexa-2, 4-dien-1-one at 2.3a resolution (see paper)
46% identity, 99% coverage: 3:247/247 of query aligns to 4:239/239 of 4bnxA
- active site: G18 (= G17), S134 (= S143), Y147 (= Y156), K151 (= K160)
- binding 6-[4-(2-chloroanilino)-1H-quinazolin-2-ylidene]cyclohexa-2,4-dien-1-one: V103 (≠ L112), N104 (≠ D113), L107 (= L116), A149 (= A158), G153 (= G162), G156 (≠ A165), F157 (= F166)
Query Sequence
>GFF2840 FitnessBrowser__Marino:GFF2840
MQDLKGKVALVTGASRGIGRHIALQLAQRGADVAINYRSRQSEGEEVAKEIEATGVRALS
FKADLSKMPEARSLVRQVQEQWGRIDILVNNAGITKDKSMKKLTDDDWNDVLDTNLGSVY
ATCSEVLKIMMDQKYGRIINITSFVGQAGNFGQANYAASKGGIIAFTKTLALEMAKYNIT
VNAIAPGFTETEMLAQVPENIREQIIARVPMGRFGKPEEIARAVVFLAAEGDYITGQQIN
VNGGVYM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory