Comparing GFF2840 FitnessBrowser__Phaeo:GFF2840 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1iomA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
43% identity, 98% coverage: 7:377/377 of query aligns to 1:374/374 of 1iomA
1ixeA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
43% identity, 98% coverage: 7:377/377 of query aligns to 1:371/371 of 1ixeA
P39120 Citrate synthase 2; Citrate synthase II; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
39% identity, 98% coverage: 9:377/377 of query aligns to 5:371/372 of P39120
6abyA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with oxaloacetate (see paper)
37% identity, 99% coverage: 5:377/377 of query aligns to 1:370/372 of 6abyA
6abxA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with citrate (see paper)
37% identity, 99% coverage: 5:377/377 of query aligns to 1:370/370 of 6abxA
1aj8A Citrate synthase from pyrococcus furiosus (see paper)
37% identity, 98% coverage: 7:377/377 of query aligns to 1:370/371 of 1aj8A
I6Y9Q3 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
37% identity, 96% coverage: 7:369/377 of query aligns to 28:387/393 of I6Y9Q3
O34002 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Antarctic bacterium DS2-3R (see 2 papers)
36% identity, 96% coverage: 7:369/377 of query aligns to 6:376/379 of O34002
Sites not aligning to the query:
1a59A Cold-active citrate synthase (see paper)
36% identity, 96% coverage: 7:369/377 of query aligns to 4:374/377 of 1a59A
2c6xA Structure of bacillus subtilis citrate synthase
35% identity, 96% coverage: 7:368/377 of query aligns to 1:360/363 of 2c6xA
6s87D Crystal structure of 2-methylcitrate synthase (prpc) from pseudomonas aeruginosa in complex with oxaloacetate.
34% identity, 98% coverage: 10:377/377 of query aligns to 1:365/365 of 6s87D
P39119 Citrate synthase 1; Citrate synthase I; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
35% identity, 96% coverage: 7:368/377 of query aligns to 2:361/366 of P39119
6abwA Crystal structure of citrate synthase (msed_0281) from metallosphaera sedula in complex with acetyl-coa (see paper)
33% identity, 97% coverage: 12:377/377 of query aligns to 1:369/369 of 6abwA
2h12B Structure of acetobacter aceti citrate synthase complexed with oxaloacetate and carboxymethyldethia coenzyme a (cmx) (see paper)
34% identity, 95% coverage: 19:377/377 of query aligns to 52:426/426 of 2h12B
P9WPD5 Citrate synthase 1; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 95% coverage: 18:377/377 of query aligns to 56:431/431 of P9WPD5
3msuA Crystal structure of citrate synthase from francisella tularensis
34% identity, 94% coverage: 18:371/377 of query aligns to 61:415/415 of 3msuA
4jagA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with oxaloacetate (see paper)
35% identity, 94% coverage: 19:371/377 of query aligns to 54:420/426 of 4jagA
4jaeA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with s- carboxymethyl-coa (see paper)
35% identity, 94% coverage: 19:371/377 of query aligns to 54:420/426 of 4jaeA
P0ABH7 Citrate synthase; EC 2.3.3.16 from Escherichia coli (strain K12) (see 2 papers)
35% identity, 94% coverage: 19:371/377 of query aligns to 55:421/427 of P0ABH7
3msuB Crystal structure of citrate synthase from francisella tularensis
33% identity, 94% coverage: 18:371/377 of query aligns to 61:426/426 of 3msuB
>GFF2840 FitnessBrowser__Phaeo:GFF2840
MSDDVKINRGLKGIYFERSGVSDIDGAKGELSYRGYSIHNLATHSTFEEVCYLLIHGELP
TADQLAGFDAALKSARVLPAPVLDIIRATKDGHPMDVLRTAVSALAALDPDSQQVGEDAF
IANGIRLISQVPIIIAAHDAIRNGRAVVTPDMDLSHAGNWLWMLKGEKPTPEATRLADVD
FILHAEHGANASSFAARVTIGTETNLHGGIVTALSTLAGPAHGGAAEDVMKMVHEIGTPD
KAAAYVKAKRAAKEAVTGFGHRVYRKEDPRARHMRDGVRQLGAEMGAPEWYEILQAVVEA
MQPYARHGLNVNVDFYSGVIYQLHGIAMDLYVPIFAIGRMPGWIIQCIEQQRGNILIRPL
TLYNGPEPRAYTPINTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory