Comparing GFF2850 FitnessBrowser__Marino:GFF2850 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
3wlxA Crystal structure of low-specificity l-threonine aldolase from escherichia coli
56% identity, 99% coverage: 1:333/336 of query aligns to 1:330/331 of 3wlxA
4lnmA Structure of escherichia coli threonine aldolase in complex with serine (see paper)
55% identity, 99% coverage: 1:333/336 of query aligns to 1:330/331 of 4lnmA
4rjyA Crystal structure of e. Coli l-threonine aldolase in complex with a non-covalently uncleaved bound l-serine substrate (see paper)
55% identity, 99% coverage: 1:333/336 of query aligns to 1:330/332 of 4rjyA
4lnlA Structure of escherichia coli threonine aldolase in complex with allo- thr (see paper)
55% identity, 99% coverage: 1:333/336 of query aligns to 1:330/332 of 4lnlA
4lnjA Structure of escherichia coli threonine aldolase in unliganded form (see paper)
55% identity, 99% coverage: 1:333/336 of query aligns to 1:330/332 of 4lnjA
O07051 L-allo-threonine aldolase; L-allo-TA; L-allo-threonine acetaldehyde-lyase; EC 4.1.2.49 from Aeromonas jandaei (see paper)
55% identity, 99% coverage: 2:333/336 of query aligns to 4:335/338 of O07051
3wgcB Aeromonas jandaei l-allo-threonine aldolase h128y/s292r double mutant (see paper)
54% identity, 99% coverage: 2:333/336 of query aligns to 3:332/333 of 3wgcB
3wgbD Crystal structure of aeromonas jandaei l-allo-threonine aldolase (see paper)
55% identity, 97% coverage: 2:326/336 of query aligns to 2:317/324 of 3wgbD
1jg8D Crystal structure of threonine aldolase (low-specificity)
48% identity, 99% coverage: 1:334/336 of query aligns to 2:340/344 of 1jg8D
1lw5B X-ray structure of l-threonine aldolase (low-specificity) in complex with glycine (see paper)
48% identity, 99% coverage: 1:334/336 of query aligns to 1:339/343 of 1lw5B
1lw4B X-ray structure of l-threonine aldolase (low-specificity) in complex with l-allo-threonine (see paper)
48% identity, 99% coverage: 1:334/336 of query aligns to 1:339/343 of 1lw4B
Q8RXU4 Low-specificity L-threonine aldolase 1; Threonine aldolase 1; EC 4.1.2.48 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
44% identity, 99% coverage: 2:332/336 of query aligns to 6:347/358 of Q8RXU4
5vyeB Crystal structure of l-threonine aldolase from pseudomonas putida
28% identity, 98% coverage: 4:331/336 of query aligns to 6:339/344 of 5vyeB
O50584 Low specificity L-threonine aldolase; Low specificity L-TA; EC 4.1.2.48 from Pseudomonas sp. (strain NCIMB 10558) (see paper)
29% identity, 98% coverage: 4:331/336 of query aligns to 8:341/346 of O50584
1v72A Crystal structure of phenylserine aldolase from pseudomonas putida
23% identity, 98% coverage: 2:331/336 of query aligns to 5:342/345 of 1v72A
>GFF2850 FitnessBrowser__Marino:GFF2850
MIDFRSDTVTRPTPEMREAMASAEVGDDVYGDDPTVNSLQAYAAERLGFEAALFTATGTQ
ANLLAIMSHCGRGDEYLCGQSAHNYKYEGGGAAVLGSVQPQPIENEPDGSIDLEKARAAI
KADDFHFAVTRLLSLENTIGGKVLPLDYQAQARAFCDEHGLLLHLDGARIFNAAVKSNCD
VTEITRHYDSVSVCLSKGLGAPVGSLLLGSESFIKRATRLRKMVGGGMRQAGILAAAGRI
ALEKGPLRLLEDHENAEYLSNGLAKIPELEVNPASTQTNIVYARCKAGQASQLKDYLAEQ
GILITAGDPIRFVTHQDVSREDVDTLLTAIRQFYPS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory