SitesBLAST
Comparing GFF2854 PS417_14575 MFS transporter to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
26% identity, 55% coverage: 30:272/445 of query aligns to 56:283/444 of Q8NLB7
- D57 (= D31) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R83) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
25% identity, 81% coverage: 78:438/445 of query aligns to 63:439/446 of A0A0H2VG78
- R102 (= R125) mutation to A: Loss of transport activity.
- I105 (≠ Q128) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E145) mutation to A: Loss of transport activity.
- Q137 (≠ P160) mutation to A: Loss of transport activity.
- Q250 (≠ G247) mutation to A: Loss of transport activity.
- Q251 (≠ A248) mutation to A: Loss of transport activity.
- N256 (≠ T253) mutation to A: Loss of transport activity.
- W357 (≠ A355) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
23% identity, 49% coverage: 16:233/445 of query aligns to 40:266/583 of Q9Y7Q9
Sites not aligning to the query:
- 267 modified: Phosphoserine
- 269 modified: Phosphoserine
- 289 modified: Phosphoserine
- 290 modified: Phosphoserine
- 292 modified: Phosphoserine
- 330 modified: Phosphoserine
O15244 Solute carrier family 22 member 2; Organic cation transporter 2; hOCT2 from Homo sapiens (Human) (see 8 papers)
25% identity, 39% coverage: 72:243/445 of query aligns to 162:314/555 of O15244
- M165 (≠ I75) to I: lower Vmax for MPP(+) transport; no change in transport efficiency (Vmax/Km) and clearance of cyclo(his-pro) and salsolinol; dbSNP:rs8177507
- Y169 (≠ M79) mutation to F: No change in TEA uptake.
- T201 (≠ A111) to M: in dbSNP:rs145450955
- Y241 (≠ V159) mutation to F: Slight decrease in TEA uptake. No change in tyrosine phosphorylation. Strong decrease in TEA uptake; when associated with F-362. Strong decrease in TEA and metformin uptake and YES1-mediated tyrosine phosphorylation; when associated with F-362 and F-377.
- Y257 (= Y175) mutation to F: No change in TEA uptake.
- S270 (≠ A198) to A: decreased Ki value for TBA inhibition of MPP(+); no change in transport efficiency (Vmax/Km) and clearance of cyclo(his-pro) and salsolinol; dbSNP:rs316019
- Y279 (= Y207) mutation to F: No change in TEA uptake.
- Y280 (≠ L208) mutation to F: No change in TEA uptake.
- P284 (≠ D213) mutation to A: Decreased TEA and metformin uptake. Decreased tyrosine phosphorylation.
- PESPR 284:288 (≠ DETPA 213:217) Proline-rich sequence
- S286 (≠ T215) mutation to A: No change in TEA and metformin uptake. No change in tyrosine phosphorylation.
- P287 (= P216) mutation to A: Decreased TEA and metformin uptake. Decreased tyrosine phosphorylation.
Sites not aligning to the query:
- 54 P → S: in dbSNP:rs8177504
- 73 Y→F: No change in TEA uptake.
- 92 Y→F: No change in TEA uptake.
- 128 Y→F: No change in TEA uptake.
- 362 Y→F: Decreased TEA uptake and YES1-mediated tyrosine phosphorylation. Strong decrease in TEA uptake; when associated with F-241. Strong decrease in TEA uptake; when associated with F-377. Strong decrease in TEA and metformin uptake and YES1-mediated tyrosine phosphorylation; when associated with F-241 and F-377.
- 377 Y→F: Slight decrease in TEA uptake. No change in tyrosine phosphorylation. Strong decrease in TEA uptake; when associated with F-362. Strong decrease in TEA and metformin uptake and YES1-mediated tyrosine phosphorylation; when associated with F-241 and F-362.
- 400 R → C: lower Vmax and reduced Ki value for TBA inhibition of MPP(+); lower transport efficiency (Vmax/Km) and clearance of cyclo(his-pro); no change in transport efficiency (Vmax/Km) and clearance of salsolinol; dbSNP:rs8177516
- 432 K → Q: lower Km value for MPP(+) and reduced Ki value for TBA inhibition of MPP; no change in transport efficiency (Vmax/Km) and clearance of cyclo(his-pro) and salsolinol; dbSNP:rs8177517
- 458 Y→F: No change in TEA uptake.
- 544 Y→F: No change in TEA uptake.
Query Sequence
>GFF2854 PS417_14575 MFS transporter
MTSPSTEQVSPQTLRKVIIAAGIGNFVEWFDFAVYGFLATTIAQQFFPSGDASAALLKTF
AVFAVAFAFRPLGGIFFGMLGDRIGRKRTLAMTILLMAGATTLIGLLPTYAAIGVAAPIL
LSLIRCAQGFSAGGEYAGACAYLMEHAPSDKRAWYGSFVPVSTFSAFAAAAVVAYALEAS
LSAEAMGSWGWRLPFLIAAPLGLVGLYLRWKLDETPAFQAVKEEHTVAHSPLKETLRNHG
AAISCLGAFVSLTALSFYMFTTYFATYLQVAGGLSRAMALLVSLIALIFAAAICPLAGLY
SDRVGRRATVMTACVLLMVVVYPSFLMASSGSFAASIVGVMLLAVGAVLCGVVTAALLSE
TFPTRTRYTASAITYNLAYTIFGGTAPLMATWLISTTGSNLSPAFYLIAVALLALAGGLA
LPETSRISLHDVGAEDKSSAPVLSR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory