Comparing GFF2860 HP15_2804 oligopeptide/dipeptide ABC transporter, ATP-binding protein-like protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
37% identity, 47% coverage: 6:323/672 of query aligns to 3:324/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
37% identity, 49% coverage: 3:330/672 of query aligns to 1:325/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
37% identity, 47% coverage: 6:321/672 of query aligns to 3:306/310 of 4fwiB
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
38% identity, 34% coverage: 374:603/672 of query aligns to 15:248/253 of 7z15I
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
38% identity, 34% coverage: 374:603/672 of query aligns to 15:248/250 of 7z18I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
38% identity, 34% coverage: 374:603/672 of query aligns to 15:248/250 of 7z16I
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 35% coverage: 373:605/672 of query aligns to 16:247/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
39% identity, 35% coverage: 373:605/672 of query aligns to 17:248/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
39% identity, 35% coverage: 373:605/672 of query aligns to 17:248/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
39% identity, 35% coverage: 373:605/672 of query aligns to 17:248/344 of 3tuiC
Sites not aligning to the query:
1g291 Malk (see paper)
37% identity, 35% coverage: 368:601/672 of query aligns to 12:242/372 of 1g291
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
37% identity, 33% coverage: 377:601/672 of query aligns to 21:245/375 of 2d62A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
36% identity, 36% coverage: 15:258/672 of query aligns to 6:236/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
38% identity, 36% coverage: 23:261/672 of query aligns to 15:239/241 of 4u00A
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
37% identity, 36% coverage: 22:261/672 of query aligns to 15:241/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
37% identity, 36% coverage: 22:261/672 of query aligns to 15:241/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
37% identity, 36% coverage: 22:261/672 of query aligns to 15:241/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
37% identity, 36% coverage: 22:261/672 of query aligns to 15:241/242 of 2oljA
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
34% identity, 35% coverage: 371:608/672 of query aligns to 10:242/384 of 8hplC
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
35% identity, 35% coverage: 375:609/672 of query aligns to 19:243/353 of 1vciA
Sites not aligning to the query:
>GFF2860 HP15_2804 oligopeptide/dipeptide ABC transporter, ATP-binding protein-like protein
MNMASILDIQDLSVDIPTDSSTLHAVRGISLELNRGETLGIVGESGSGKSMTALALMNLL
PPAAKRQASCIDFDGSDLTHATERELASKIRGQRIGMIFQEPMTSLNPVYSIGRQLKETM
TLHRKVSDTEAENRAVYLLEKVGLPDPASRLKQYPHELSGGQRQRVMIAMALMNEPELLI
ADEPTTALDVTIQAQILHLLRELQQEFGMSMILITHDLGVVSRAADNIAVMYAGDIVETG
KTGEVLENPRHPYTKGLLECVPGYKGQSQQRLGAIPGIVPAMTGDISGCAFASRCPRAAG
VCRTTNPPTKKLHQGRYFVCHEPDVEGRGLAAERPTASERTVTSNVRGTEDILTVDHVSC
TFSVRRGMFGKRKPLQALDDVSLTLKKGEVLALVGESGCGKTTLTRTIMGLQAPSTGSVT
LNGQRIENLPPMDRARMIQPIFQDPYSSLNPRKTIGEIIAKPLFVHGIGSNQEQHQQVRK
MMELVGLPSRVFNSYPDQLSGGQRQRAAIGRALILNPEVVICDEPTSALDVSVQAQILNL
LLDLRDELDLTYLFVTHNLSVVQHMADRVAVMYLGEIVECGERDQVMSDPKHPYTHALMN
SALSISPGESVPDPGLSGDFPNPMNRPSGCPFHPRCPLADQQCREQAPGPELIDNTLVQC
WKARTAGNQLKS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory