Comparing GFF2865 FitnessBrowser__WCS417:GFF2865 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
33% identity, 98% coverage: 4:283/287 of query aligns to 2:288/294 of Q9X1K9
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
32% identity, 99% coverage: 4:286/287 of query aligns to 3:292/295 of 1o5kA
4fhaA Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
33% identity, 95% coverage: 12:283/287 of query aligns to 15:290/307 of 4fhaA
1xxxA Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis (see paper)
34% identity, 91% coverage: 11:272/287 of query aligns to 15:278/296 of 1xxxA
P9WP25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 91% coverage: 11:272/287 of query aligns to 19:282/300 of P9WP25
5j5dA Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid (see paper)
34% identity, 91% coverage: 11:272/287 of query aligns to 16:279/297 of 5j5dA
Sites not aligning to the query:
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
32% identity, 92% coverage: 4:268/287 of query aligns to 2:271/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
32% identity, 92% coverage: 4:268/287 of query aligns to 2:271/292 of P0A6L2
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
32% identity, 92% coverage: 4:268/287 of query aligns to 3:272/293 of 5t25A
3l21B The crystal structure of a dimeric mutant of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis - dhdps- a204r
34% identity, 91% coverage: 11:272/287 of query aligns to 14:277/295 of 3l21B
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
29% identity, 99% coverage: 1:284/287 of query aligns to 2:290/295 of 5ktlA
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
32% identity, 92% coverage: 4:268/287 of query aligns to 2:271/292 of 3i7sA
7kg2A Dihydrodipicolinate synthase (dhdps) from c.Jejuni, h59k mutant with pyruvate bound in the active site and l-histidine bound at the allosteric site
29% identity, 98% coverage: 6:287/287 of query aligns to 6:292/296 of 7kg2A
4m19A Dihydrodipicolinate synthase from c. Jejuni with pyruvate bound to the active site and lysine bound to allosteric site (see paper)
29% identity, 98% coverage: 6:287/287 of query aligns to 6:292/296 of 4m19A
7kkdB Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84a mutant with pyruvate bound in the active site and r,r-bislysine bound at the allosteric site
28% identity, 98% coverage: 6:287/287 of query aligns to 16:302/306 of 7kkdB
6u01B Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84d mutant with pyruvate bound in the active site (see paper)
28% identity, 98% coverage: 6:287/287 of query aligns to 6:292/296 of 6u01B
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
31% identity, 93% coverage: 3:268/287 of query aligns to 1:270/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
31% identity, 93% coverage: 3:268/287 of query aligns to 1:270/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
31% identity, 93% coverage: 3:268/287 of query aligns to 1:270/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
31% identity, 93% coverage: 3:268/287 of query aligns to 1:270/291 of 3tceA
>GFF2865 FitnessBrowser__WCS417:GFF2865
MSSFQGIWVPVVTPFHDGAIDFTGLHRLVSHLLEKHVAGIMVCTTTGEAAALSRQEQLAV
LDAVLQWVPAHRVVMGLAGYNQIELLQFQREILQRPVAGLLVPAPSYIRPSQAGLEAFFR
TVADASSVPIILYDIPYRTGATFEQATLLNIVAHERIVAIKDCGGNLGNTLALLASGDVE
VLCGEDVQIFNALCLGATGAIAASAHLQTEQFVALCQLVRDNQLAEARATFFELLPLINA
MFMEPNPAPVKAALALQGLIGSELRAPMQAASTAVVARLQQVLNPTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory