SitesBLAST
Comparing GFF2881 FitnessBrowser__WCS417:GFF2881 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8a56B Coenzyme a-persulfide reductase (coapr) from enterococcus faecalis (see paper)
31% identity, 35% coverage: 8:307/846 of query aligns to 3:312/539 of 8a56B
- binding flavin-adenine dinucleotide: I6 (≠ G11), G7 (≠ N12), V9 (≠ M14), G11 (= G16), E32 (≠ S38), K33 (≠ E39), C42 (≠ V48), V80 (= V83), S109 (≠ A108), P110 (≠ T109), G111 (= G110), I159 (≠ L156), G278 (= G279), D279 (≠ E280), S295 (≠ G290), L296 (= L291), A297 (≠ V292)
- binding 3'-phosphate-adenosine-5'-diphosphate: T17 (≠ Q22), R18 (≠ L23), R21 (= R26), F70 (≠ L77), R305 (= R300)
Sites not aligning to the query:
Q9HTK9 Rubredoxin-NAD(+) reductase; RdxR; EC 1.18.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
28% identity, 44% coverage: 1:375/846 of query aligns to 1:366/384 of Q9HTK9
2v3aA Crystal structure of rubredoxin reductase from pseudomonas aeruginosa. (see paper)
28% identity, 44% coverage: 7:375/846 of query aligns to 4:363/381 of 2v3aA
- active site: L11 (≠ M14), K42 (≠ R47), P43 (≠ V48), M290 (≠ Y296)
- binding flavin-adenine dinucleotide: I7 (≠ V10), G8 (= G11), T9 (≠ N12), G10 (= G13), A12 (≠ V15), T33 (≠ S38), A34 (≠ E39), D35 (≠ E40), K42 (≠ R47), P43 (≠ V48), R79 (≠ P82), V80 (= V83), A105 (= A108), W106 (≠ T109), G107 (= G110), I153 (≠ L156), F157 (≠ A160), D274 (≠ E280), L284 (≠ G290), Y285 (≠ L291), V286 (= V292), K317 (= K324)
3nt6A Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant (see paper)
30% identity, 34% coverage: 50:334/846 of query aligns to 45:362/565 of 3nt6A
- active site: N325 (≠ Y296)
- binding coenzyme a: A321 (≠ V292), N325 (≠ Y296), R329 (= R300)
- binding flavin-adenine dinucleotide: E80 (≠ P82), V81 (= V83), S112 (≠ A108), P113 (≠ T109), G114 (= G110), L133 (≠ Y129), R134 (= R130), F161 (≠ L155), G302 (= G279), D303 (≠ E280), P319 (≠ G290), L320 (= L291), A321 (≠ V292)
Sites not aligning to the query:
- active site: 11, 38, 42, 43, 471, 472
- binding coenzyme a: 11, 18, 19, 22, 39, 42, 43, 459, 462, 463, 466, 534, 535
- binding flavin-adenine dinucleotide: 7, 8, 10, 11, 12, 33, 34, 42, 43
6pfzA Structure of a NAD-dependent persulfide reductase from a. Fulgidus (see paper)
33% identity, 25% coverage: 85:294/846 of query aligns to 88:303/541 of 6pfzA
Sites not aligning to the query:
- active site: 37, 42, 455, 456
- binding calcium ion: 306, 332, 427, 428
- binding coenzyme a: 14, 18, 21, 38, 40, 42, 76, 313, 430, 447, 512, 513, 516
- binding flavin-adenine dinucleotide: 7, 11, 32, 33, 41, 42, 86, 304, 305
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
30% identity, 39% coverage: 1:331/846 of query aligns to 1:346/422 of P16640
- A15 (≠ V15) binding
- D37 (≠ E39) binding
- K50 (≠ E52) binding
- V83 (= V83) binding
- R134 (= R130) binding
- D284 (≠ E280) binding
- V302 (= V292) binding
Q8U1K9 NAD(P)H:rubredoxin oxidoreductase; NROR; Rubredoxin--NAD(P)(+) reductase; EC 1.18.1.4 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
29% identity, 44% coverage: 7:376/846 of query aligns to 3:343/359 of Q8U1K9
1xhcA Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779- 001
31% identity, 35% coverage: 7:306/846 of query aligns to 3:286/346 of 1xhcA
- active site: P10 (≠ M14), K38 (≠ R47), P39 (≠ V48), F145 (≠ L155), E149 (= E159), M276 (≠ Y296)
- binding flavin-adenine dinucleotide: V6 (= V10), G7 (= G11), G9 (= G13), P10 (≠ M14), G11 (≠ V15), D29 (≠ S38), K30 (≠ E39), K38 (≠ R47), P39 (≠ V48), E74 (≠ P82), A75 (≠ V83), A100 (= A108), T101 (= T109), G102 (= G110), L119 (≠ Y129), R120 (= R130), F145 (≠ L155), I146 (≠ L156), E149 (= E159), G259 (= G279), D260 (≠ E280), G270 (= G290), T271 (≠ L291), A272 (≠ V292)
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
30% identity, 39% coverage: 2:331/846 of query aligns to 1:345/422 of 1q1wA
- active site: L13 (≠ M14), L44 (≠ R47), P45 (≠ V48), L305 (≠ Y296)
- binding flavin-adenine dinucleotide: G10 (= G11), G12 (= G13), L13 (≠ M14), A14 (≠ V15), G35 (≠ S38), D36 (≠ E39), L44 (≠ R47), P45 (≠ V48), K49 (≠ E52), V82 (= V83), A108 (= A108), T109 (= T109), G110 (= G110), R133 (= R130), I159 (≠ L156), D283 (≠ E280), S300 (vs. gap), V301 (= V292), W329 (≠ G316)
6rvhA Nadh-dependent coenzyme a disulfide reductase soaked with menadione (see paper)
30% identity, 26% coverage: 60:283/846 of query aligns to 58:284/443 of 6rvhA
Sites not aligning to the query:
- active site: 39, 44, 53, 425, 430
- binding coenzyme a: 20, 23, 40, 41, 44, 303, 307, 359, 431, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 34, 35, 43, 44, 297, 298, 299, 424, 425
- binding menadione: 364, 365, 430, 431
6rvbA Nadh-dependent coenzyme a disulfide reductase soaked with nadh (see paper)
30% identity, 26% coverage: 60:283/846 of query aligns to 58:284/443 of 6rvbA
- active site: E58 (= E60), Y159 (≠ L155), E163 (= E159)
- binding coenzyme a: R63 (≠ S65)
- binding flavin-adenine dinucleotide: E80 (≠ P82), V81 (= V83), T113 (= T109), G114 (= G110), L133 (≠ Y129), R134 (= R130), I160 (≠ L156), G280 (= G279), D281 (≠ E280)
- binding nicotinamide-adenine-dinucleotide: G156 (= G152), G158 (= G154), Y159 (≠ L155), I160 (≠ L156), E179 (= E175), A180 (≠ F176), A240 (≠ S239), T241 (≠ A240), G242 (= G241)
Sites not aligning to the query:
- active site: 39, 44, 53, 425, 430
- binding coenzyme a: 15, 20, 23, 40, 41, 44, 303, 307, 359, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 36, 43, 44, 298, 299, 424, 425
- binding nicotinamide-adenine-dinucleotide: 297, 328, 329
6ruzA Nadh-dependent coenzyme a disulfide reductase (see paper)
30% identity, 26% coverage: 60:283/846 of query aligns to 58:284/443 of 6ruzA
- active site: E58 (= E60), Y159 (≠ L155), E163 (= E159)
- binding coenzyme a: R63 (≠ S65)
- binding flavin-adenine dinucleotide: E80 (≠ P82), V81 (= V83), T113 (= T109), G114 (= G110), A115 (≠ S111), L133 (≠ Y129), R134 (= R130), Y159 (≠ L155), G280 (= G279), D281 (≠ E280)
Sites not aligning to the query:
- active site: 39, 44, 53, 425, 430
- binding coenzyme a: 15, 19, 20, 23, 40, 41, 44, 303, 307, 359, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 43, 44, 297, 298, 299, 424, 425
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
29% identity, 39% coverage: 6:331/846 of query aligns to 3:337/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G11), G10 (= G13), H11 (≠ M14), A12 (≠ V15), D34 (≠ E39), E35 (= E40), R42 (= R47), P43 (≠ V48), S46 (= S51), K47 (≠ E52), R78 (≠ P82), M79 (≠ V83), T106 (= T109), R127 (= R130), I153 (≠ L156), D275 (≠ E280), S292 (≠ L291), V293 (= V292), W321 (vs. gap)
3ictA Crystal structure of reduced bacillus anthracis coadr-rhd (see paper)
26% identity, 28% coverage: 101:334/846 of query aligns to 109:347/557 of 3ictA
Sites not aligning to the query:
- active site: 15, 42, 46, 47, 430, 456, 457
- binding coenzyme a: 15, 18, 22, 23, 26, 43, 46, 47, 439, 451, 520, 521, 524
- binding flavin-adenine dinucleotide: 12, 14, 16, 37, 38, 46, 47, 85
3icsB Crystal structure of partially reduced bacillus anthracis coadr-rhd (see paper)
26% identity, 28% coverage: 101:334/846 of query aligns to 106:344/554 of 3icsB
- active site: N306 (≠ Y296)
- binding adenosine-5'-diphosphate: G162 (= G154), I164 (≠ L156), E183 (= E175), M184 (≠ F176), P190 (= P182), I244 (≠ A240), G245 (= G241)
- binding coenzyme a: N306 (≠ Y296), R310 (= R300)
- binding flavin-adenine dinucleotide: S113 (≠ A108), P114 (≠ T109), G115 (= G110), L135 (≠ Y129), R136 (= R130), I164 (≠ L156), L252 (= L248), G283 (= G279), D284 (≠ E280), P300 (≠ G290), L301 (= L291), A302 (≠ V292), A305 (≠ G295)
Sites not aligning to the query:
- active site: 12, 39, 43, 44, 427, 453, 454
- binding coenzyme a: 12, 15, 16, 19, 20, 23, 40, 43, 44, 428, 436, 441, 444, 445, 448, 517, 518, 521
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 34, 35, 43, 44, 82
8pxkA Structure of nadh-dependent ferredoxin reductase, bpha4, solved at wavelength 5.76 a (see paper)
31% identity, 34% coverage: 7:290/846 of query aligns to 7:280/403 of 8pxkA
- binding flavin-adenine dinucleotide: G13 (= G13), A15 (≠ V15), D37 (≠ E39), E38 (= E40), R45 (= R47), P46 (≠ V48), K50 (≠ E52), A79 (≠ V83), T106 (= T109), G107 (= G110), R127 (= R130), I153 (≠ L156), G269 (= G279), D270 (≠ E280)
Sites not aligning to the query:
1f3pA Ferredoxin reductase (bpha4)-nadh complex (see paper)
31% identity, 34% coverage: 7:290/846 of query aligns to 6:279/401 of 1f3pA
- active site: L13 (≠ M14), R44 (= R47), P45 (≠ V48)
- binding flavin-adenine dinucleotide: A14 (≠ V15), V34 (≠ F37), D36 (≠ E39), E37 (= E40), R44 (= R47), P45 (≠ V48), A78 (≠ V83), T105 (= T109), G106 (= G110), R126 (= R130), G268 (= G279), D269 (≠ E280)
- binding nicotinamide-adenine-dinucleotide: V147 (= V151), G148 (= G152), G150 (= G154), V151 (≠ L155), I152 (≠ L156), E155 (= E159), E171 (= E175), T172 (≠ F176), R179 (vs. gap), G230 (≠ S239), I231 (≠ A240), G232 (= G241), V233 (≠ I242)
Sites not aligning to the query:
2yvjA Crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex (see paper)
31% identity, 34% coverage: 7:290/846 of query aligns to 6:279/402 of 2yvjA
- active site: L13 (≠ M14), R44 (= R47), P45 (≠ V48)
- binding flavin-adenine dinucleotide: G10 (= G11), G12 (= G13), G35 (≠ S38), D36 (≠ E39), E37 (= E40), R44 (= R47), P45 (≠ V48), A78 (≠ V83), T105 (= T109), G106 (= G110), R126 (= R130), G268 (= G279), D269 (≠ E280)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V147 (= V151), G148 (= G152), G149 (= G153), G150 (= G154), I152 (≠ L156), V170 (= V174), E171 (= E175), T172 (≠ F176), R179 (vs. gap), G230 (≠ S239), I231 (≠ A240), G232 (= G241), V233 (≠ I242)
Sites not aligning to the query:
2gr2A Crystal structure of ferredoxin reductase, bpha4 (oxidized form)
31% identity, 34% coverage: 7:290/846 of query aligns to 5:278/401 of 2gr2A
- active site: L12 (≠ M14), R43 (= R47), P44 (≠ V48)
- binding adenosine-5-diphosphoribose: R109 (vs. gap), V146 (= V151), G147 (= G152), G149 (= G154), V150 (≠ L155), I151 (≠ L156), E170 (= E175), T171 (≠ F176), R178 (vs. gap), G229 (≠ S239), I230 (≠ A240), G231 (= G241)
- binding flavin-adenine dinucleotide: G11 (= G13), A13 (≠ V15), D35 (≠ E39), E36 (= E40), R43 (= R47), P44 (≠ V48), K48 (≠ E52), A77 (≠ V83), T104 (= T109), G105 (= G110), R125 (= R130), G267 (= G279), D268 (≠ E280)
Sites not aligning to the query:
2gr0A Crystal structure of ferredoxin reductase, bpha4 (oxidized form, NAD+ complex) (see paper)
31% identity, 34% coverage: 7:290/846 of query aligns to 5:278/401 of 2gr0A
- active site: L12 (≠ M14), R43 (= R47), P44 (≠ V48)
- binding adenosine-5'-diphosphate: V146 (= V151), G147 (= G152), G149 (= G154), I151 (≠ L156), E170 (= E175), T171 (≠ F176), R178 (vs. gap), G229 (≠ S239), I230 (≠ A240), G231 (= G241)
- binding flavin-adenine dinucleotide: G11 (= G13), A13 (≠ V15), D35 (≠ E39), E36 (= E40), R43 (= R47), P44 (≠ V48), K48 (≠ E52), T76 (≠ P82), A77 (≠ V83), T104 (= T109), G105 (= G110), R125 (= R130), I151 (≠ L156), G267 (= G279), D268 (≠ E280)
Sites not aligning to the query:
Query Sequence
>GFF2881 FitnessBrowser__WCS417:GFF2881
MNNLKTLIVVGNGMVGHHCVAQLIERGALDHYRLHVFSEEPMRAYDRVHLSEYFSGRDAE
SLALSDASLYQTPGVTLHLGVPVLEIDRARCEVITADGCVAYDKLVLATGSYPFVPPIDG
AEGDSRLVYRTLEDLDAIRKAAANARRGVVVGGGLLGLEAANALKSLGLEAHVVEFAPRL
MPVQLDDFGGLALKAQIERLGVGVHLSRATQSISAGEHYRYRMNFANDEFLETDLIVFSA
GIRAQDALARQAGLDIGPRGGVVINDECLSCDPNIYAIGECASWNGSLFGLVAPGYQMAR
GVAALLCKQTAEPFVGADMSTKLKLLGVDVGSIGDAHAHTPGARSYQFIDEASASYRRLV
VDASGKQVIGAVLVGDNSYYDTLLQYMQNGIALPSEPASLILPSAAGAPTLGPGALPESA
TVCSCHNVTKGAICSAIDSGCSDLGLLKSQTKACTGCGGCAGLLKQVFEHELIARGVSVD
KSLCEHFAYTRQELYALVRVEGIITFDELLAKHGRGHTGCDVCKPAVGSILASCWNQPIM
DASLVPLQDTNDTFMANMQKNGTYSVVPRIPGGEITADKLIVIGEVAKKYDLYTKITGGQ
RIDLFGAQLHELPDIWSELIAAGFETGHAYGKSTRTVKSCVGSTWCRYGVQDSVKMALQI
EDRYKGLRSPHKLKFAVSGCTRECAEAQSKDVGVIATEKGWNLYIAGNGGMRPRHAELFA
TDLDDATLIQYIDRFLMFYIRTADKLQRTSVWRESLEGGLDFLKDVILHDSLGLGAELEA
QMQQVVDRYECEWANALADPEKLKRFRTFVNDKRPDPDIHFVQERGQRRPIMAAELNLIP
VTEEIA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory