Comparing GFF2883 FitnessBrowser__Marino:GFF2883 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
60% identity, 100% coverage: 1:329/329 of query aligns to 1:328/331 of P80874
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
60% identity, 100% coverage: 1:329/329 of query aligns to 1:328/333 of 1pz1A
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
39% identity, 88% coverage: 1:288/329 of query aligns to 1:286/310 of P46336
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
39% identity, 87% coverage: 3:288/329 of query aligns to 2:285/311 of 1pz0A
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
39% identity, 88% coverage: 1:288/329 of query aligns to 1:298/326 of P77256
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
36% identity, 65% coverage: 1:213/329 of query aligns to 2:206/298 of 1ynqB
Sites not aligning to the query:
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
36% identity, 65% coverage: 1:213/329 of query aligns to 2:206/298 of 1ynpB
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
36% identity, 70% coverage: 1:230/329 of query aligns to 2:221/275 of 6kiyA
Sites not aligning to the query:
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
36% identity, 70% coverage: 1:230/329 of query aligns to 2:221/275 of 6kikA
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
36% identity, 70% coverage: 1:230/329 of query aligns to 1:220/274 of 5danA
Sites not aligning to the query:
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
30% identity, 95% coverage: 1:311/329 of query aligns to 1:292/301 of 6ow0B
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
29% identity, 83% coverage: 1:272/329 of query aligns to 1:270/337 of Q3L181
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
30% identity, 95% coverage: 1:311/329 of query aligns to 1:316/323 of 6ow0A
1ynpA Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
35% identity, 65% coverage: 1:213/329 of query aligns to 2:191/283 of 1ynpA
Sites not aligning to the query:
8hw0A The structure of akr6d1
31% identity, 98% coverage: 1:322/329 of query aligns to 1:327/329 of 8hw0A
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 80% coverage: 5:268/329 of query aligns to 11:301/351 of Q9P7U2
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
31% identity, 94% coverage: 1:308/329 of query aligns to 11:318/335 of 4aubB
Sites not aligning to the query:
6ciaA Crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with NADPH.
35% identity, 69% coverage: 1:227/329 of query aligns to 1:212/284 of 6ciaA
Sites not aligning to the query:
4wghA Crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with NADP and acetate at 1.8 a resolution
35% identity, 65% coverage: 13:227/329 of query aligns to 13:211/283 of 4wghA
Sites not aligning to the query:
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
31% identity, 95% coverage: 1:312/329 of query aligns to 13:314/315 of 5t79A
>GFF2883 FitnessBrowser__Marino:GFF2883
MDKRTFGNTDIQVTPVGLGTWAIGGWMWGGTDEAQSIDTIHRAIDKGIGLVDTAPVYGFG
RSEEIVGKALSDGRRDQVALATKVALNWNDDHDKVWRDASASRIEREVEDSLKRLQTDRI
DIYQVHWPDPKTPMEETARALEKLYQAGKIRAIGVSNFTPSQMDELQKSVPLHSLQPPYN
LFEREIEQDILPYCRENGIATITYGGLCRGFLTGKMREDTQFTGDDLRKNDPKFQGDRYR
QYLNAVAELDAFARERYQKSVLALALRWLVDQPGVTTALWGARRPEQLDPVDEIDGWSLD
KNAMAEIDGILDRCITDPVGPEFMAPPTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory