Comparing GFF2891 FitnessBrowser__WCS417:GFF2891 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 91% coverage: 26:480/500 of query aligns to 64:577/587 of P25297
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 73% coverage: 40:405/500 of query aligns to 56:393/444 of Q8NLB7
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
23% identity, 69% coverage: 88:434/500 of query aligns to 63:413/446 of A0A0H2VG78
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 34% coverage: 82:253/500 of query aligns to 98:278/583 of Q9Y7Q9
Sites not aligning to the query:
6rw3A The molecular basis for sugar import in malaria parasites. (see paper)
22% identity, 61% coverage: 131:435/500 of query aligns to 99:422/437 of 6rw3A
8fvzA Pipt y150a
23% identity, 87% coverage: 26:461/500 of query aligns to 4:431/433 of 8fvzA
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 65% coverage: 78:404/500 of query aligns to 186:496/616 of P36035
Sites not aligning to the query:
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
29% identity, 19% coverage: 74:169/500 of query aligns to 195:282/727 of Q9Z2I6
Sites not aligning to the query:
>GFF2891 FitnessBrowser__WCS417:GFF2891
MKLRKKSVKPIGLKDITIVDDTKVRKAITAAALGNAMEWFDFGVYGFVAYVLGKVFFPDA
SPSVQMIAALGTFSVPFLIRPLGGLFFGALGDKYGRQKVLAATIVIMSLSTFAIGLIPSY
ASIGIWAPILLLLCKMAQGFSVGGEYTGASIFVAEYAPDRKRGFLGSWLDFGSIAGFVLG
AGVVVLISSILGEADFESWGWRLPFFLALPLGIIGLYLRHALEETPAFQQHMDKMEQGDR
EGLTHGPKVSFKEVATKHWRSLLTCIGIVAATNVTYYMLLTYMPSYLSHNLHYKENSGVL
IIIAIMVGMLFVQPFIGFISDKIGRKPFIIAGSIGLLFLSIPAFMLITSGKIGLIFAGLL
ILAVILNFFIGVMASTLPAMFPTHLRYSALASAFNVSVLIAGLTPTAVAWLVESTNDLYM
PAYYLMVFAVVGLITGLTMKETANKPLRGAAPAASDMEEAKELLQEHHDNIEQKIEDIDA
EIAELEAKRKNLVEQHPRIN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory