Comparing GFF2914 FitnessBrowser__WCS417:GFF2914 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A3QCW5 C4-dicarboxylate-binding periplasmic protein DctP from Shewanella loihica (strain ATCC BAA-1088 / PV-4) (see paper)
54% identity, 98% coverage: 8:327/327 of query aligns to 16:336/336 of A3QCW5
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
27% identity, 91% coverage: 25:321/327 of query aligns to 4:301/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
27% identity, 91% coverage: 25:321/327 of query aligns to 4:301/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
27% identity, 91% coverage: 25:321/327 of query aligns to 4:301/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
27% identity, 91% coverage: 25:321/327 of query aligns to 4:301/310 of 7bcnA
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
27% identity, 91% coverage: 25:321/327 of query aligns to 5:302/310 of 7bbrA
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
28% identity, 91% coverage: 29:325/327 of query aligns to 6:310/314 of 4p8bA
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
26% identity, 94% coverage: 3:311/327 of query aligns to 4:312/328 of Q0B2F6
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
28% identity, 87% coverage: 26:310/327 of query aligns to 4:287/304 of 4x8rA
4n17A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate (see paper)
28% identity, 78% coverage: 57:311/327 of query aligns to 32:286/301 of 4n17A
Sites not aligning to the query:
4n15A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-glucuronate (see paper)
28% identity, 78% coverage: 57:311/327 of query aligns to 32:286/301 of 4n15A
Sites not aligning to the query:
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
28% identity, 79% coverage: 57:313/327 of query aligns to 32:287/300 of 4n8yA
Sites not aligning to the query:
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
26% identity, 100% coverage: 1:326/327 of query aligns to 1:328/329 of P44542
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
27% identity, 91% coverage: 27:324/327 of query aligns to 3:299/303 of 4pddA
3b50A Structure of h. Influenzae sialic acid binding protein bound to neu5ac. (see paper)
26% identity, 91% coverage: 28:326/327 of query aligns to 5:305/310 of 3b50A
2cexA Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
26% identity, 91% coverage: 28:326/327 of query aligns to 4:304/304 of 2cexA
Sites not aligning to the query:
2cexB Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
26% identity, 91% coverage: 28:326/327 of query aligns to 4:304/305 of 2cexB
Sites not aligning to the query:
2v4cA Structure of sialic acid binding protein (siap) in the presence of kdn (see paper)
26% identity, 91% coverage: 28:326/327 of query aligns to 5:305/309 of 2v4cA
4mnpA Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. Nucleatum atcc 25586 (see paper)
28% identity, 87% coverage: 42:324/327 of query aligns to 18:302/305 of 4mnpA
2wx9A Crystal structure of the sialic acid binding periplasmic protein siap (see paper)
26% identity, 91% coverage: 28:326/327 of query aligns to 5:305/308 of 2wx9A
>GFF2914 FitnessBrowser__WCS417:GFF2914
MLKLSRALLCAATLFAAGLAQAADPIVIKFAHVVAENTPKGQGALLFKKLAQERLPGRVK
VEVYPNSSLFGDGKEMEALLLGDVQMLAPSLAKFEQYTQQVQIYDLPFLFNDLAAVDRFQ
AAQGKALLTAMQDKNILGLAYWHNGLKQLSSNKALHEPKDARGLKFRVQASSVLEEQFKA
IRANPRKMSFAEVYQGLQTGTVNGTENTWSNYESQKVNEVQKYFTESNHGLIDYMVITNA
TFWNGLPPDIRSTLEQIMVEVTVEVNKQAEALNQSAKQKIIDAKTSEIIELTPEQRQLWR
EAMRPVWQKFEGEIGADLIKAADASNQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory