SitesBLAST
Comparing GFF2924 FitnessBrowser__Phaeo:GFF2924 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 70% coverage: 3:259/366 of query aligns to 46:300/459 of P9WIT1
Sites not aligning to the query:
- 354 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
33% identity, 48% coverage: 22:198/366 of query aligns to 68:243/465 of 3pm9A
- active site: A149 (≠ V104), L159 (≠ A114)
- binding flavin-adenine dinucleotide: P69 (≠ S23), Q70 (≠ G24), G71 (= G25), G72 (= G26), N73 (≠ T27), T74 (≠ R28), G75 (= G29), L76 (= L30), G79 (= G34), Q80 (≠ E35), L91 (≠ V39), L133 (= L88), G134 (= G89), A135 (≠ T90), C139 (≠ P94), T140 (= T95), G142 (= G97), G143 (= G98), S146 (≠ A101), T147 (≠ A102), A149 (≠ V104), G150 (≠ S105), E200 (≠ H155), G201 (= G156), I205 (≠ V160), I206 (≠ L161)
Sites not aligning to the query:
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
30% identity, 50% coverage: 5:188/366 of query aligns to 53:236/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (= V22), G75 (= G24), S76 (≠ G25), G77 (= G26), T78 (= T27), G79 (= G29), L80 (= L30), A83 (vs. gap), C84 (vs. gap), P137 (≠ H84), G138 (= G89), E139 (≠ T90), A142 (≠ P94), T143 (= T95), G146 (= G98), N147 (≠ V99), S149 (≠ A101), T150 (≠ A102), A152 (≠ V104), G153 (≠ S105), E203 (≠ H155), G204 (= G156), I209 (≠ L161)
Sites not aligning to the query:
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
31% identity, 54% coverage: 1:197/366 of query aligns to 104:301/521 of Q8N465
- S109 (≠ E6) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ S23) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G26) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ T36) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ L42) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ T61) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P81) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A101) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ G127) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G129) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 375 D → Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- 386 binding ; binding ; binding ; R→A: Loss of catalytic activity.
- 390 binding ; binding ; T→A: Significantly reduced catalytic activity.
- 399 V → M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
- 401 binding ; binding ; K→A: Loss of catalytic activity.
- 419 R → H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- 426 A → T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- 434 binding ; H→A: Loss of catalytic activity.
- 436 G → V: slight reduction in catalytic activity
- 439 N → D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- 441 binding ; H→A: Loss of catalytic activity.
- 443 binding ; N→A: Significantly reduced catalytic activity.
- 444 V → A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- 446 A → V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- 475 binding ; E→A: Loss of catalytic activity.
- 476 binding ; binding ; binding ; H→A: Loss of catalytic activity.
- 477 G → R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
31% identity, 54% coverage: 1:197/366 of query aligns to 51:248/466 of 6lpxA
- binding flavin-adenine dinucleotide: P75 (vs. gap), Q76 (≠ G24), G77 (= G25), G78 (= G26), N79 (≠ T27), T80 (≠ R28), G81 (= G29), M82 (≠ L30), G85 (= G33), S86 (≠ G34), L139 (= L88), G140 (= G89), A141 (≠ T90), C145 (≠ P94), G149 (= G98), N150 (≠ V99), A152 (= A101), T153 (≠ A102), G157 (= G106), G207 (= G156), I212 (≠ L161)
Sites not aligning to the query:
- binding 2-oxoglutaric acid: 333, 337, 348, 379, 381, 388, 423
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding zinc ion: 381, 388, 422
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
31% identity, 54% coverage: 1:197/366 of query aligns to 51:248/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (vs. gap), G77 (= G25), G78 (= G26), N79 (≠ T27), T80 (≠ R28), G81 (= G29), G85 (= G33), S86 (≠ G34), L139 (= L88), G140 (= G89), A141 (≠ T90), C145 (≠ P94), H146 (≠ T95), G148 (= G97), G149 (= G98), N150 (≠ V99), A152 (= A101), T153 (≠ A102), A155 (≠ V104), E206 (≠ H155), G207 (= G156), I211 (≠ V160), I212 (≠ L161)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding (2s)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 423
- binding zinc ion: 381, 388, 422
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
31% identity, 54% coverage: 1:197/366 of query aligns to 51:248/466 of 6lpqA
- binding flavin-adenine dinucleotide: P75 (vs. gap), G77 (= G25), G78 (= G26), N79 (≠ T27), T80 (≠ R28), G81 (= G29), G85 (= G33), S86 (≠ G34), L139 (= L88), G140 (= G89), A141 (≠ T90), C145 (≠ P94), H146 (≠ T95), G149 (= G98), N150 (≠ V99), A152 (= A101), T153 (≠ A102), A155 (≠ V104), G157 (= G106), E206 (≠ H155), G207 (= G156), I211 (≠ V160), I212 (≠ L161)
- binding d-malate: M82 (≠ L30)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding d-malate: 333, 337, 348, 379, 381, 388, 422, 423
- binding zinc ion: 381, 388, 422
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
31% identity, 54% coverage: 1:197/366 of query aligns to 51:248/466 of 6lppA
- binding flavin-adenine dinucleotide: P75 (vs. gap), G77 (= G25), G78 (= G26), N79 (≠ T27), T80 (≠ R28), G81 (= G29), M82 (≠ L30), G85 (= G33), S86 (≠ G34), L139 (= L88), G140 (= G89), A141 (≠ T90), C145 (≠ P94), G149 (= G98), N150 (≠ V99), A152 (= A101), T153 (≠ A102), A155 (≠ V104), G157 (= G106), G207 (= G156), I212 (≠ L161)
Sites not aligning to the query:
- binding (2R)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 390, 423
- binding flavin-adenine dinucleotide: 39, 422, 423
- binding zinc ion: 381, 388, 422
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
31% identity, 54% coverage: 1:197/366 of query aligns to 52:249/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (vs. gap), G78 (= G25), G79 (= G26), N80 (≠ T27), T81 (≠ R28), G82 (= G29), M83 (≠ L30), G86 (= G33), S87 (≠ G34), L140 (= L88), A142 (≠ T90), C146 (≠ P94), H147 (≠ T95), G150 (= G98), N151 (≠ V99), A153 (= A101), T154 (≠ A102), G208 (= G156), I212 (≠ V160), I213 (≠ L161)
Sites not aligning to the query:
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 36% coverage: 37:166/366 of query aligns to 116:238/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
4bc7B Mammalian alkyldihydroxyacetonephosphate synthase: arg419his mutant (see paper)
25% identity, 43% coverage: 36:192/366 of query aligns to 163:311/543 of 4bc7B
- binding flavin-adenine dinucleotide: P208 (= P81), D209 (≠ G89), S210 (≠ T90), S214 (≠ P94), T215 (= T95), G218 (= G98), S221 (≠ A101), T222 (≠ A102), A224 (≠ V104), S225 (= S105), E274 (≠ H155), G275 (= G156), I280 (≠ L161)
Sites not aligning to the query:
- binding 1-dodecanol: 410, 412
- binding flavin-adenine dinucleotide: 16, 140, 142, 143, 144, 145, 146, 147, 150, 151, 501
P97275 Alkyldihydroxyacetonephosphate synthase, peroxisomal; Alkyl-DHAP synthase; Alkylglycerone-phosphate synthase; EC 2.5.1.26 from Cavia porcellus (Guinea pig) (see 4 papers)
25% identity, 43% coverage: 36:192/366 of query aligns to 257:405/658 of P97275
- H300 (≠ F79) mutation to A: Loss of activity.
- 303:309 (vs. 89:95, 14% identical) binding
- T309 (= T95) mutation to I: Impaired FAD binding and protein stability. Loss of activity.
- TRAS 316:319 (≠ ANVS 102:105) binding
- S367 (= S154) mutation to A: Strongly reduced activity.
- 368:374 (vs. 155:161, 71% identical) binding
Sites not aligning to the query:
- 1:58 modified: transit peptide, Peroxisome
- 234:240 binding
- 419 Important for enzyme activity; R→H: Loss of activity.; R→K: Strongly reduced activity.
- 469 L→P: Impaired FAD binding and protein stability. Loss of activity.
- 515 binding ; R→L: Impaired FAD binding and protein stability. Loss of activity.
- 576 C→A: No effect on activity.
- 578 active site, Proton donor/acceptor; Y→F: Loss of activity.
- 615 H→A: Loss of activity.
- 615:617 Important for enzyme activity
- 616 H→A: Loss of activity.
- 617 H→A: Loss of activity.
- 654:658 Important for enzyme activity
5adzC Ether lipid-generating enzyme agps in complex with inhibitor 1a (see paper)
25% identity, 43% coverage: 36:192/366 of query aligns to 177:325/557 of 5adzC
- binding flavin-adenine dinucleotide: P222 (= P81), D223 (≠ G89), S224 (≠ T90), S228 (≠ P94), T229 (= T95), G232 (= G98), W233 (≠ V99), S235 (≠ A101), T236 (≠ A102), A238 (≠ V104), S239 (= S105), E288 (≠ H155), G289 (= G156), I294 (≠ L161)
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): D223 (≠ G89)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 154, 155, 156, 157, 158, 159, 160, 515
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): 410, 414, 424, 425, 426, 477, 515, 516
5ae2B Ether lipid-generating enzyme agps in complex with inhibitor 1e (see paper)
25% identity, 43% coverage: 36:192/366 of query aligns to 163:311/542 of 5ae2B
- binding flavin-adenine dinucleotide: P208 (= P81), D209 (≠ G89), S210 (≠ T90), S214 (≠ P94), T215 (= T95), G218 (= G98), W219 (≠ V99), S221 (≠ A101), T222 (≠ A102), A224 (≠ V104), S225 (= S105), E274 (≠ H155), G275 (= G156), V279 (= V160), I280 (≠ L161)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 140, 142, 143, 144, 145, 146, 150, 151, 500
- binding 3-(2-fluorophenyl)-2-methyl-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)acrylamide: 399, 409, 410, 411, 462, 464, 466, 500, 501
4bc9B Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
25% identity, 43% coverage: 36:192/366 of query aligns to 163:311/542 of 4bc9B
- binding propanenitrile: D209 (≠ G89)
- binding flavin-adenine dinucleotide: P208 (= P81), D209 (≠ G89), S210 (≠ T90), S214 (≠ P94), T215 (= T95), G218 (= G98), W219 (≠ V99), S221 (≠ A101), T222 (≠ A102), A224 (≠ V104), S225 (= S105), E274 (≠ H155), G275 (= G156), I280 (≠ L161)
Sites not aligning to the query:
- binding propanenitrile: 462, 501
- binding flavin-adenine dinucleotide: 140, 142, 143, 144, 145, 146, 147, 150, 151, 500
5ae1B Ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 (see paper)
25% identity, 43% coverage: 36:192/366 of query aligns to 163:311/539 of 5ae1B
- binding flavin-adenine dinucleotide: P208 (= P81), D209 (≠ G89), S210 (≠ T90), S214 (≠ P94), T215 (= T95), G218 (= G98), W219 (≠ V99), S221 (≠ A101), T222 (≠ A102), A224 (≠ V104), S225 (= S105), E274 (≠ H155), V279 (= V160), I280 (≠ L161)
Sites not aligning to the query:
- binding (3-(2-fluorophenyl)-n-(1-(2-oxo-2,3-dihydro-1h-benzo[d]imidazol-5-yl)ethyl)butanamide): 392, 396, 406, 407, 408, 459, 497
- binding flavin-adenine dinucleotide: 16, 140, 141, 142, 143, 144, 145, 146, 150, 151, 497, 535
6gouA Development of alkyl glycerone phosphate synthase inhibitors: complex with inhibitor 2i (see paper)
25% identity, 43% coverage: 36:192/366 of query aligns to 177:325/554 of 6gouA
- binding (3~{S})-3-[2,6-bis(fluoranyl)phenyl]-~{N}-[(2-oxidanylidene-1,3-dihydrobenzimidazol-5-yl)methyl]butanamide: D223 (≠ G89)
- binding flavin-adenine dinucleotide: P222 (= P81), D223 (≠ G89), S224 (≠ T90), S228 (≠ P94), T229 (= T95), G232 (= G98), W233 (≠ V99), S235 (≠ A101), T236 (≠ A102), A238 (≠ V104), S239 (= S105), E288 (≠ H155), V293 (= V160), I294 (≠ L161)
Sites not aligning to the query:
- binding (3~{S})-3-[2,6-bis(fluoranyl)phenyl]-~{N}-[(2-oxidanylidene-1,3-dihydrobenzimidazol-5-yl)methyl]butanamide: 411, 421, 422, 423, 474, 476, 478
- binding flavin-adenine dinucleotide: 16, 154, 155, 156, 157, 158, 159, 160, 161, 164, 512
4bc9A Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
25% identity, 43% coverage: 36:192/366 of query aligns to 168:316/555 of 4bc9A
- binding propanenitrile: D214 (≠ G89)
- binding flavin-adenine dinucleotide: P213 (= P81), D214 (≠ G89), S215 (≠ T90), S219 (≠ P94), T220 (= T95), G223 (= G98), W224 (≠ V99), S226 (≠ A101), T227 (≠ A102), A229 (≠ V104), S230 (= S105), E279 (≠ H155), V284 (= V160), I285 (≠ L161)
Sites not aligning to the query:
- binding propanenitrile: 475, 513, 514
- binding flavin-adenine dinucleotide: 145, 146, 147, 148, 149, 150, 151, 152, 155, 156, 513
5ae3A Ether lipid-generating enzyme agps in complex with antimycin a (see paper)
25% identity, 43% coverage: 36:192/366 of query aligns to 163:311/539 of 5ae3A
- binding flavin-adenine dinucleotide: P208 (= P81), D209 (≠ G89), S210 (≠ T90), S214 (≠ P94), T215 (= T95), G218 (= G98), W219 (≠ V99), S221 (≠ A101), T222 (≠ A102), A224 (≠ V104), S225 (= S105), E274 (≠ H155), V279 (= V160), I280 (≠ L161)
Sites not aligning to the query:
- binding [(2R,3S,6S,7R,8R)-3-[(3-formamido-2-oxidanyl-phenyl)carbonylamino]-8-hexyl-2,6-dimethyl-4,9-bis(oxidanylidene)-1,5-dioxonan-7-yl] 3-methylbutanoate: 45, 49, 53, 325, 327, 331, 334, 349, 386, 393, 396, 400, 447, 461
- binding flavin-adenine dinucleotide: 140, 141, 142, 143, 144, 145, 146, 147, 151, 497
O00116 Alkyldihydroxyacetonephosphate synthase, peroxisomal; Alkyl-DHAP synthase; Aging-associated gene 5 protein; Alkylglycerone-phosphate synthase; EC 2.5.1.26 from Homo sapiens (Human) (see 2 papers)
24% identity, 43% coverage: 36:192/366 of query aligns to 257:405/658 of O00116
Sites not aligning to the query:
- 182 R → Q: in RCDP3; severely reduced protein levels
- 419 Important for enzyme activity; R → H: in RCDP3; loss of enzyme activity; dbSNP:rs121434411
- 471 E → K: in RCDP3; severely reduced protein levels
- 568 T → M: in RCDP3; does not affect protein levels; dbSNP:rs387907214
Query Sequence
>GFF2924 FitnessBrowser__Phaeo:GFF2924
MTPQSEAELAQIIVGATAPLAVSGGGTRGLSTGGETLSVAGLNGVTLYEPGALTLVVQAG
TSVEEVQALLAGENQRLAFEPMDHRGLLGTKGTPTIGGVFAANVSGPRRIQCGAARDFLL
GVRFVDGRGDVLSNGGRVMKNVTGYDLVKLMAGSHGTLGVLSEVSLKVLPCSEACATVTV
HVADLTSAVAAMSTALGSPYDVTGAAYDPEAGAVYIRVEGFEASVTYRAEALKMALGKFG
EVSLALGAGDALWEGIRNVAAFHDRPGDVWRISVKPSDAVALAPALEAEGLLFDWGGGLI
WALVPAGRDLRFRLTVPGHATLVRASAQTRAELGQFQPQPGPLAAISGGLRRQFDPRGIL
NPGLMG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory