SitesBLAST
Comparing GFF2925 FitnessBrowser__Phaeo:GFF2925 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
32% identity, 88% coverage: 40:465/482 of query aligns to 33:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P80), G75 (= G82), S76 (≠ A83), G77 (= G84), T78 (= T85), G79 (≠ S86), L80 (= L87), A83 (≠ G90), C84 (≠ A91), P137 (= P144), G138 (≠ S145), E139 (≠ S146), A142 (≠ C150), T143 (≠ A151), G146 (= G154), N147 (= N155), S149 (≠ A157), T150 (≠ M158), A152 (≠ S160), G153 (= G161), E203 (= E210), G204 (= G211), I209 (≠ V216), E422 (= E424), H423 (= H425)
- binding fe (iii) ion: H377 (= H380), H384 (= H387), E422 (= E424)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
28% identity, 87% coverage: 48:466/482 of query aligns to 35:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (= G90), V79 (≠ A91), L90 (≠ V102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ M158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), W322 (≠ F336), E413 (= E424), H414 (= H425), N450 (= N461)
- binding lactic acid: R318 (= R332), H369 (= H380), H376 (= H387), H414 (= H425)
- binding manganese (ii) ion: H369 (= H380), H376 (= H387), E413 (= E424)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
28% identity, 87% coverage: 46:466/482 of query aligns to 33:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R332), H369 (= H380), H376 (= H387), H414 (= H425)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (= G90), V79 (≠ A91), L90 (≠ V102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ M158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), W322 (≠ F336), E413 (= E424), H414 (= H425), N450 (= N461)
- binding manganese (ii) ion: H369 (= H380), H376 (= H387), E413 (= E424)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
28% identity, 87% coverage: 48:466/482 of query aligns to 35:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (= G90), V79 (≠ A91), L90 (≠ V102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ M158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), W323 (≠ F336), E414 (= E424), H415 (= H425), N451 (= N461)
- binding manganese (ii) ion: H370 (= H380), H377 (= H387), E414 (= E424)
- binding pyruvic acid: R319 (= R332), H370 (= H380), H377 (= H387), H415 (= H425)
Sites not aligning to the query:
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
28% identity, 87% coverage: 48:466/482 of query aligns to 35:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L87), R317 (= R332), W321 (≠ F336), H368 (= H380), H375 (= H387), H413 (= H425)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (= G90), V79 (≠ A91), L90 (≠ V102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ M158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), W321 (≠ F336), Y322 (≠ G337), E412 (= E424), H413 (= H425), N449 (= N461)
- binding manganese (ii) ion: H368 (= H380), H375 (= H387), E412 (= E424)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
28% identity, 87% coverage: 48:466/482 of query aligns to 35:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R332), W322 (≠ F336), H369 (= H380), H376 (= H387), H414 (= H425)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (= G90), V79 (≠ A91), L90 (≠ V102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ M158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), W322 (≠ F336), E413 (= E424), N450 (= N461)
- binding manganese (ii) ion: H369 (= H380), H376 (= H387), E413 (= E424)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
28% identity, 87% coverage: 48:466/482 of query aligns to 35:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (= G90), V79 (≠ A91), L90 (≠ V102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ M158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), H369 (= H380), E413 (= E424), N450 (= N461)
- binding deaminohydroxyvaline: R319 (= R332), H414 (= H425)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
28% identity, 87% coverage: 48:466/482 of query aligns to 35:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (= G90), V79 (≠ A91), L90 (≠ V102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ M158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), Y324 (≠ G337), H370 (= H380), E414 (= E424), N451 (= N461)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R332), W323 (≠ F336), H415 (= H425)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
28% identity, 87% coverage: 48:466/482 of query aligns to 35:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R332), W323 (≠ F336), H370 (= H380), H415 (= H425)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (= G90), V79 (≠ A91), L90 (≠ V102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ M158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), H370 (= H380), E414 (= E424), N451 (= N461)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
28% identity, 87% coverage: 48:466/482 of query aligns to 35:456/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R332), W323 (≠ F336), H415 (= H425)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (= G90), V79 (≠ A91), L90 (≠ V102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ M158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), Y324 (≠ G337), H370 (= H380), E414 (= E424), N451 (= N461)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
28% identity, 87% coverage: 48:466/482 of query aligns to 35:456/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (= G90), V79 (≠ A91), L90 (≠ V102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ M158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), H370 (= H380), E414 (= E424), N451 (= N461)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R332), W323 (≠ F336), H415 (= H425)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
28% identity, 87% coverage: 48:466/482 of query aligns to 35:456/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (= G90), V79 (≠ A91), L90 (≠ V102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ M158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), H370 (= H380), E414 (= E424), N451 (= N461)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R332), H415 (= H425)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
28% identity, 87% coverage: 48:466/482 of query aligns to 35:456/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (= G90), V79 (≠ A91), L90 (≠ V102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ M158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), Y324 (≠ G337), H370 (= H380), E414 (= E424), N451 (= N461)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ L87), R319 (= R332), W323 (≠ F336), H415 (= H425)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
28% identity, 87% coverage: 48:466/482 of query aligns to 35:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (= G90), V79 (≠ A91), L90 (≠ V102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ M158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), W322 (≠ F336), E413 (= E424), H414 (= H425), N450 (= N461)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R332), H369 (= H380), H376 (= H387), H414 (= H425)
- binding manganese (ii) ion: H369 (= H380), H376 (= H387), E413 (= E424)
Sites not aligning to the query:
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 94% coverage: 15:466/482 of query aligns to 2:456/459 of P9WIT1
- K354 (≠ H359) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
30% identity, 91% coverage: 29:467/482 of query aligns to 24:465/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R332), T337 (≠ F336), K348 (≠ C347), Y379 (≠ V378), H381 (= H380), H388 (= H387), H423 (= H425)
- binding flavin-adenine dinucleotide: W39 (≠ A44), P75 (= P80), Q76 (≠ R81), G77 (= G82), G78 (≠ A83), N79 (≠ G84), T80 (= T85), G81 (≠ S86), M82 (≠ L87), G85 (= G90), S86 (≠ A91), L139 (≠ P144), G140 (≠ S145), A141 (≠ S146), C145 (= C150), G149 (= G154), N150 (= N155), A152 (= A157), T153 (≠ M158), G157 (= G162), G207 (= G211), I212 (≠ V216), E422 (= E424), N459 (= N461)
- binding zinc ion: H381 (= H380), H388 (= H387), E422 (= E424)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
30% identity, 91% coverage: 29:467/482 of query aligns to 24:465/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (≠ A44), P75 (= P80), G77 (= G82), G78 (≠ A83), N79 (≠ G84), T80 (= T85), G81 (≠ S86), G85 (= G90), S86 (≠ A91), L139 (≠ P144), G140 (≠ S145), A141 (≠ S146), C145 (= C150), H146 (≠ A151), G148 (≠ A153), G149 (= G154), N150 (= N155), A152 (= A157), T153 (≠ M158), A155 (≠ S160), E206 (= E210), G207 (= G211), I211 (≠ V215), I212 (≠ V216), E422 (= E424), N459 (= N461)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R332), T337 (≠ F336), K348 (≠ C347), Y379 (≠ V378), H381 (= H380), H388 (= H387), H423 (= H425)
- binding zinc ion: H381 (= H380), H388 (= H387), E422 (= E424)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
30% identity, 91% coverage: 29:467/482 of query aligns to 24:465/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (≠ A44), P75 (= P80), G77 (= G82), G78 (≠ A83), N79 (≠ G84), T80 (= T85), G81 (≠ S86), G85 (= G90), S86 (≠ A91), L139 (≠ P144), G140 (≠ S145), A141 (≠ S146), C145 (= C150), H146 (≠ A151), G149 (= G154), N150 (= N155), A152 (= A157), T153 (≠ M158), A155 (≠ S160), G157 (= G162), E206 (= E210), G207 (= G211), I211 (≠ V215), I212 (≠ V216), E422 (= E424), N459 (= N461)
- binding d-malate: M82 (≠ L87), R333 (= R332), T337 (≠ F336), K348 (≠ C347), Y379 (≠ V378), H381 (= H380), H388 (= H387), E422 (= E424), H423 (= H425)
- binding zinc ion: H381 (= H380), H388 (= H387), E422 (= E424)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
30% identity, 91% coverage: 29:467/482 of query aligns to 24:465/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R332), T337 (≠ F336), K348 (≠ C347), Y379 (≠ V378), H381 (= H380), H388 (= H387), N390 (≠ L389), H423 (= H425)
- binding flavin-adenine dinucleotide: W39 (≠ A44), P75 (= P80), G77 (= G82), G78 (≠ A83), N79 (≠ G84), T80 (= T85), G81 (≠ S86), M82 (≠ L87), G85 (= G90), S86 (≠ A91), L139 (≠ P144), G140 (≠ S145), A141 (≠ S146), C145 (= C150), G149 (= G154), N150 (= N155), A152 (= A157), T153 (≠ M158), A155 (≠ S160), G157 (= G162), G207 (= G211), I212 (≠ V216), E422 (= E424), H423 (= H425)
- binding zinc ion: H381 (= H380), H388 (= H387), E422 (= E424)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
30% identity, 91% coverage: 29:467/482 of query aligns to 25:466/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (≠ A44), P76 (= P80), G78 (= G82), G79 (≠ A83), N80 (≠ G84), T81 (= T85), G82 (≠ S86), M83 (≠ L87), G86 (= G90), S87 (≠ A91), L140 (≠ P144), A142 (≠ S146), C146 (= C150), H147 (≠ A151), G150 (= G154), N151 (= N155), A153 (= A157), T154 (≠ M158), G208 (= G211), I212 (≠ V215), I213 (≠ V216), E423 (= E424), N460 (= N461)
Query Sequence
>GFF2925 FitnessBrowser__Phaeo:GFF2925
MEMPIPDQTVLSQKTELALRLAAVLPDDALVQDPAETRAYECDALTAYKCPPMLVVLPRT
TKEVSDVLRICHAAGVPVVPRGAGTSLAGGALPTADCVILGVARMNAVLETDYDNRIIRV
QTGRTNLSVSGAVEEEEFFYAPDPSSQLACAIAGNIAMNSGGAHCLKYGVTTNNLMGVTM
VMMDGTVVEIGGAHLDAGGLDLLGVICGSEGQLGVVTEATLRILRKPEGARPVLIGYDSN
EVAGACVSDIIKAGVLPVAIEFMDRPCIEACEAFAKAGYPMCEALLIVEVEGSDAEIDHQ
LRLITEIARSHNPVELREARDSDEAARIWLGRKSAFGAMGQINDYMCLDGTIPVTSLPHV
LRRIGEMSKEFGLDVANVFHAGDGNMHPLILFDANKPGDLETCEAFGAEILKLCVEVGGC
LTGEHGVGIEKRDLMLDQYGVADIEAQLRVKDVFDPKWLLNPAKVFPLSTTQSRRTPAVT
PL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory