Comparing GFF293 FitnessBrowser__WCS417:GFF293 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
37% identity, 98% coverage: 5:249/250 of query aligns to 2:257/260 of P02911
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
39% identity, 90% coverage: 22:245/250 of query aligns to 2:223/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
39% identity, 90% coverage: 22:245/250 of query aligns to 2:225/226 of 4zv1A
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
38% identity, 92% coverage: 21:249/250 of query aligns to 1:235/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
38% identity, 92% coverage: 21:249/250 of query aligns to 1:235/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
38% identity, 92% coverage: 21:249/250 of query aligns to 1:235/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
38% identity, 92% coverage: 21:249/250 of query aligns to 1:235/238 of 1lafE
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
38% identity, 90% coverage: 24:249/250 of query aligns to 1:232/235 of 5owfA
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
38% identity, 92% coverage: 21:249/250 of query aligns to 1:235/238 of 1hslA
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
38% identity, 91% coverage: 22:249/250 of query aligns to 24:257/260 of P02910
Sites not aligning to the query:
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
37% identity, 91% coverage: 22:249/250 of query aligns to 24:257/260 of P0AEU0
Sites not aligning to the query:
3tqlA Structure of the amino acid abc transporter, periplasmic amino acid- binding protein from coxiella burnetii. (see paper)
41% identity, 89% coverage: 23:245/250 of query aligns to 1:225/225 of 3tqlA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
35% identity, 91% coverage: 19:245/250 of query aligns to 1:227/228 of 2y7iA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
34% identity, 92% coverage: 16:245/250 of query aligns to 5:230/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
34% identity, 92% coverage: 16:245/250 of query aligns to 9:234/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
34% identity, 92% coverage: 16:245/250 of query aligns to 9:234/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
34% identity, 92% coverage: 16:245/250 of query aligns to 9:234/241 of 3vvdA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
36% identity, 88% coverage: 25:245/250 of query aligns to 11:228/229 of 5t0wA
8hqrA Crystal structure of the arginine-/lysine-binding protein sar11_1210 from 'candidatus pelagibacter ubique' htcc1062 bound to arginine
31% identity, 89% coverage: 26:247/250 of query aligns to 10:263/267 of 8hqrA
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
27% identity, 89% coverage: 24:245/250 of query aligns to 2:248/254 of 5otaA
>GFF293 FitnessBrowser__WCS417:GFF293
MQNYKKFLLAAAVSMAFSATAMAETLKMGIEAAYPPFNNKDASGNVVGFDKDIGDALCAK
MKVEKCEVYVSDWDGIIPALNAKKFDFLVSSLSITEERKAAVDFTDPYYSNKLQFIAPKA
TADFKTDAAYLKGKVIGAQRATLAGTYLEDKLPDTEAKLYDTQENAYLDLTSGRLDGILA
DKYVQYEWLKSKDGSAYEFKGDPVVESDKIGIAVRKGDPLRERLNKALAEIKADGTYKKI
NDKYFPFSIE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory