Comparing GFF2930 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
O06976 HPr-like protein Crh; Catabolite repression HPr from Bacillus subtilis (strain 168) (see 3 papers)
39% identity, 94% coverage: 1:84/89 of query aligns to 1:84/85 of O06976
1pohA The 2.0 angstroms resolution structure of escherichia coli histidine- containing phosphocarrier protein hpr: a redetermination (see paper)
35% identity, 93% coverage: 1:83/89 of query aligns to 1:83/85 of 1pohA
1j6tB Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
35% identity, 93% coverage: 1:83/89 of query aligns to 1:83/85 of 1j6tB
P0AA04 Phosphocarrier protein HPr; Histidine-containing protein from Escherichia coli (strain K12) (see paper)
35% identity, 93% coverage: 1:83/89 of query aligns to 1:83/85 of P0AA04
Q84F84 Phosphocarrier protein HPr; Histidine-containing protein from Lysinibacillus sphaericus (Bacillus sphaericus) (see paper)
38% identity, 87% coverage: 7:83/89 of query aligns to 7:83/88 of Q84F84
O69250 Phosphocarrier protein HPr; Histidine-containing protein from Priestia megaterium (Bacillus megaterium) (see 2 papers)
38% identity, 87% coverage: 1:77/89 of query aligns to 1:77/88 of O69250
P24366 Phosphocarrier protein HPr; Histidine-containing protein from Streptococcus salivarius (see paper)
41% identity, 91% coverage: 8:88/89 of query aligns to 8:85/87 of P24366
P08877 Phosphocarrier protein HPr; Histidine-containing protein from Bacillus subtilis (strain 168) (see 5 papers)
36% identity, 87% coverage: 1:77/89 of query aligns to 1:77/88 of P08877
Q9WXK8 Phosphocarrier protein HPr; Histidine-containing protein from Streptococcus equinus (Streptococcus bovis) (see paper)
44% identity, 62% coverage: 13:67/89 of query aligns to 13:67/87 of Q9WXK8
Q9CJ83 Phosphocarrier protein HPr; Histidine-containing protein from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
37% identity, 73% coverage: 13:77/89 of query aligns to 13:77/88 of Q9CJ83
Q9F166 Phosphocarrier protein HPr from Bacillus thuringiensis subsp. israelensis (see 2 papers)
34% identity, 84% coverage: 13:87/89 of query aligns to 12:87/87 of Q9F166
>GFF2930
MIKTTVTISNKLGLHARASAKLTKLAGGFACDVWMSRGERRVNAKSIMGVMMLAAGIGSV
VEIETDGKDEQPAMDALVALVNDKFGEGE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory