Comparing GFF2932 FitnessBrowser__Phaeo:GFF2932 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
O14289 3-isopropylmalate dehydratase; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
59% identity, 100% coverage: 1:201/201 of query aligns to 537:734/758 of O14289
Sites not aligning to the query:
P9WK95 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
41% identity, 99% coverage: 1:199/201 of query aligns to 1:192/198 of P9WK95
Q58667 Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
32% identity, 72% coverage: 18:161/201 of query aligns to 13:137/170 of Q58667
2pkpA Crystal structure of 3-isopropylmalate dehydratase (leud)from methhanocaldococcus jannaschii dsm2661 (mj1271) (see paper)
32% identity, 72% coverage: 18:161/201 of query aligns to 13:137/167 of 2pkpA
P20004 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Bos taurus (Bovine) (see 2 papers)
42% identity, 26% coverage: 70:121/201 of query aligns to 658:709/780 of P20004
Sites not aligning to the query:
5acnA Structure of activated aconitase. Formation of the (4fe-4s) cluster in the crystal (see paper)
40% identity, 26% coverage: 70:121/201 of query aligns to 631:682/754 of 5acnA
Sites not aligning to the query:
P19414 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
37% identity, 32% coverage: 65:129/201 of query aligns to 647:724/778 of P19414
Sites not aligning to the query:
P39533 Homocitrate dehydratase, mitochondrial; Aconitase 2; EC 4.2.1.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 65% coverage: 48:177/201 of query aligns to 636:785/789 of P39533
Sites not aligning to the query:
>GFF2932 FitnessBrowser__Phaeo:GFF2932
MEKFTKIQGIAAPMPLVNIDTDMIIPKVFLKSIQRTGFGKNLFDEMRYNRDGSEIADFVL
NKPQYRDAEILIAGDNFGCGSSREHAPWAIADFGIRCIVSTSFADIFFNNSFKNGILPIV
LPQEQVDLLMKDAEKGANARMTVDLEAQEISTSDGEVIKFEVDAFKKHCLLNGLDDIGLT
MEKATSIASFEDKAAQERPWV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory