SitesBLAST
Comparing GFF2933 FitnessBrowser__Marino:GFF2933 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
45% identity, 98% coverage: 1:228/232 of query aligns to 6:234/240 of 1ji0A
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 93% coverage: 1:216/232 of query aligns to 2:218/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 96% coverage: 1:223/232 of query aligns to 3:227/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 96% coverage: 1:223/232 of query aligns to 3:227/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 96% coverage: 1:223/232 of query aligns to 3:227/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 96% coverage: 1:223/232 of query aligns to 3:227/242 of 2oljA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
33% identity, 93% coverage: 1:216/232 of query aligns to 2:218/240 of 6mjpA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
33% identity, 93% coverage: 1:216/232 of query aligns to 1:218/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (≠ Y11), V16 (≠ T16), S36 (≠ N36), G37 (= G37), S38 (≠ V38), G39 (= G39), K40 (= K40), S41 (≠ T41), T42 (= T42), E162 (= E159), H194 (≠ Q192)
- binding magnesium ion: S41 (≠ T41), E162 (= E159)
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
32% identity, 91% coverage: 2:211/232 of query aligns to 3:210/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Y11), S37 (≠ N36), G38 (= G37), C39 (≠ V38), G40 (= G39), K41 (= K40), S42 (≠ T41), T43 (= T42), Q81 (= Q84), R128 (= R129), A132 (≠ D133), S134 (= S135), G136 (= G137), Q137 (= Q138), E158 (= E159), H191 (≠ Q192)
- binding magnesium ion: S42 (≠ T41), Q81 (= Q84)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
32% identity, 91% coverage: 2:211/232 of query aligns to 3:210/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Y11), G38 (= G37), C39 (≠ V38), G40 (= G39), K41 (= K40), S42 (≠ T41), T43 (= T42), R128 (= R129), S134 (= S135), Q137 (= Q138)
- binding beryllium trifluoride ion: S37 (≠ N36), G38 (= G37), K41 (= K40), Q81 (= Q84), S134 (= S135), G136 (= G137), H191 (≠ Q192)
- binding magnesium ion: S42 (≠ T41), Q81 (= Q84)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
32% identity, 91% coverage: 2:211/232 of query aligns to 3:210/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Y11), V17 (≠ T16), G38 (= G37), C39 (≠ V38), G40 (= G39), K41 (= K40), S42 (≠ T41), T43 (= T42), R128 (= R129), A132 (≠ D133), S134 (= S135), Q137 (= Q138)
- binding tetrafluoroaluminate ion: S37 (≠ N36), G38 (= G37), K41 (= K40), Q81 (= Q84), S134 (= S135), G135 (= G136), G136 (= G137), E158 (= E159), H191 (≠ Q192)
- binding magnesium ion: S42 (≠ T41), Q81 (= Q84)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
32% identity, 91% coverage: 2:211/232 of query aligns to 3:210/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ Y11), V17 (≠ T16), G38 (= G37), C39 (≠ V38), G40 (= G39), K41 (= K40), S42 (≠ T41), T43 (= T42), R128 (= R129), A132 (≠ D133), S134 (= S135), Q137 (= Q138)
- binding magnesium ion: S42 (≠ T41), Q81 (= Q84)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
32% identity, 91% coverage: 2:211/232 of query aligns to 4:211/371 of P68187
- A85 (≠ Q87) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ G108) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V116) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ L119) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ P121) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (vs. gap) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G137) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D158) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
32% identity, 91% coverage: 2:211/232 of query aligns to 3:210/374 of 2awnB
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
32% identity, 91% coverage: 2:211/232 of query aligns to 1:208/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ Y11), S35 (≠ N36), G36 (= G37), C37 (≠ V38), G38 (= G39), K39 (= K40), S40 (≠ T41), T41 (= T42), R126 (= R129), A130 (≠ D133), S132 (= S135), G134 (= G137), Q135 (= Q138)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 91% coverage: 2:211/232 of query aligns to 4:211/369 of P19566
- L86 (≠ I88) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P160) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (≠ Q165) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 93% coverage: 1:216/232 of query aligns to 4:232/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 93% coverage: 1:216/232 of query aligns to 4:232/253 of 1g9xB
3d31A Modbc from methanosarcina acetivorans (see paper)
33% identity, 94% coverage: 1:217/232 of query aligns to 1:211/348 of 3d31A
Sites not aligning to the query:
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
31% identity, 98% coverage: 2:228/232 of query aligns to 11:242/257 of P0AAH0
- G48 (= G39) mutation to I: Loss of phosphate transport.
- K49 (= K40) mutation to Q: Loss of phosphate transport.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Query Sequence
>GFF2933 FitnessBrowser__Marino:GFF2933
MLKIEKLNQFYGESHTLWDLDLDVPQGQCTCVMGRNGVGKTTLMKCIMGEETTKNGSIEF
AGDVELTKKKVEDRSRLGIGYVPQGRQIFPLLTVEENLRTGLAVRKDGSKKIPERVYELF
PVLKEMRHRRGGDLSGGQQQQLAIGRALVIEPRLLILDEPGEGIQPNIVAQIGEVIRKLI
EEDGLTVLLVEQKLPFARKYADRFAILDRGRRVAEGEIAGLTDELIKKHLTV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory