Comparing GFF2934 FitnessBrowser__psRCH2:GFF2934 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
O07051 L-allo-threonine aldolase; L-allo-TA; L-allo-threonine acetaldehyde-lyase; EC 4.1.2.49 from Aeromonas jandaei (see paper)
59% identity, 97% coverage: 1:331/341 of query aligns to 1:335/338 of O07051
3wlxA Crystal structure of low-specificity l-threonine aldolase from escherichia coli
55% identity, 96% coverage: 4:331/341 of query aligns to 2:330/331 of 3wlxA
3wgcB Aeromonas jandaei l-allo-threonine aldolase h128y/s292r double mutant (see paper)
58% identity, 96% coverage: 4:331/341 of query aligns to 3:332/333 of 3wgcB
4rjyA Crystal structure of e. Coli l-threonine aldolase in complex with a non-covalently uncleaved bound l-serine substrate (see paper)
55% identity, 96% coverage: 4:331/341 of query aligns to 2:330/332 of 4rjyA
4lnlA Structure of escherichia coli threonine aldolase in complex with allo- thr (see paper)
55% identity, 96% coverage: 4:331/341 of query aligns to 2:330/332 of 4lnlA
4lnjA Structure of escherichia coli threonine aldolase in unliganded form (see paper)
55% identity, 96% coverage: 4:331/341 of query aligns to 2:330/332 of 4lnjA
4lnmA Structure of escherichia coli threonine aldolase in complex with serine (see paper)
55% identity, 96% coverage: 4:331/341 of query aligns to 2:330/331 of 4lnmA
3wgbD Crystal structure of aeromonas jandaei l-allo-threonine aldolase (see paper)
58% identity, 96% coverage: 4:331/341 of query aligns to 2:323/324 of 3wgbD
1jg8D Crystal structure of threonine aldolase (low-specificity)
44% identity, 97% coverage: 4:335/341 of query aligns to 3:344/344 of 1jg8D
1lw5B X-ray structure of l-threonine aldolase (low-specificity) in complex with glycine (see paper)
44% identity, 97% coverage: 4:335/341 of query aligns to 2:343/343 of 1lw5B
1lw4B X-ray structure of l-threonine aldolase (low-specificity) in complex with l-allo-threonine (see paper)
44% identity, 97% coverage: 4:335/341 of query aligns to 2:343/343 of 1lw4B
Q8RXU4 Low-specificity L-threonine aldolase 1; Threonine aldolase 1; EC 4.1.2.48 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
44% identity, 97% coverage: 1:330/341 of query aligns to 3:347/358 of Q8RXU4
5vyeB Crystal structure of l-threonine aldolase from pseudomonas putida
26% identity, 92% coverage: 8:321/341 of query aligns to 8:331/344 of 5vyeB
O50584 Low specificity L-threonine aldolase; Low specificity L-TA; EC 4.1.2.48 from Pseudomonas sp. (strain NCIMB 10558) (see paper)
27% identity, 68% coverage: 8:238/341 of query aligns to 10:239/346 of O50584
1v72A Crystal structure of phenylserine aldolase from pseudomonas putida
25% identity, 54% coverage: 4:187/341 of query aligns to 5:193/345 of 1v72A
Sites not aligning to the query:
>GFF2934 FitnessBrowser__psRCH2:GFF2934
MSDIDLRSDTVTQPTADMREAMFRAETGDDVYGEDPTVSRLERQLAGDLGFSAAMFVPSG
TMSNLLALMAHCERGDEYIVGQQAHTYKYEGGGAAVLGSIQPQPIEMEADGTLDLRRIEA
AIKPDNFHFARSRLLVLENTMHGKVLPLDYLAAARDFTRQRDLALHLDGARLFNAAVKLG
CDAREITRHFDTVSVCLSKGLGAPVGSVLCGDDAFIAKARRLRKMVGGGMRQAGILAAAG
LYALEHNIDRLADDHRRAEWLGNELAALGFAVEPVQTNMVYVEMGAQATALTAFCAQRGI
RLTPAARLRLVTHLDVHDEHVPRVVGAFAEFAEFAENMGRN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory