SitesBLAST
Comparing GFF2935 FitnessBrowser__WCS417:GFF2935 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
42% identity, 88% coverage: 32:310/317 of query aligns to 33:312/313 of Q65CJ7
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
42% identity, 88% coverage: 32:310/317 of query aligns to 31:310/311 of 3bazA
- active site: L98 (≠ N100), R230 (= R230), A251 (= A251), D254 (= D254), E259 (= E259), H277 (= H277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (≠ A76), G149 (= G148), L150 (= L149), G151 (= G150), R152 (≠ A151), I153 (≠ V152), S172 (≠ N172), R173 (= R173), S174 (≠ Q174), C201 (≠ T201), P202 (= P202), T207 (= T207), I228 (= I228), G229 (= G229), R230 (= R230), D254 (= D254), H277 (= H277), G279 (≠ A279)
5j23A Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose (see paper)
44% identity, 79% coverage: 64:314/317 of query aligns to 58:312/318 of 5j23A
- active site: L94 (≠ N100), R228 (= R230), D252 (= D254), E257 (= E259), H275 (= H277)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: V70 (≠ A76), L148 (= L149), G149 (= G150), R150 (≠ A151), I151 (≠ V152), T170 (≠ N172), R171 (= R173), P200 (= P202), S204 (= S206), T205 (= T207), R228 (= R230)
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
44% identity, 79% coverage: 64:314/317 of query aligns to 59:313/319 of 5v7nA
- active site: L95 (≠ N100), R229 (= R230), D253 (= D254), E258 (= E259), H276 (= H277)
- binding 2-keto-D-gluconic acid: G70 (= G75), V71 (≠ A76), G72 (= G77), R229 (= R230), H276 (= H277), S279 (≠ G280), R285 (≠ A286)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V71 (≠ A76), V99 (= V104), L149 (= L149), G150 (= G150), R151 (≠ A151), I152 (≠ V152), T171 (≠ N172), R172 (= R173), V200 (≠ T201), P201 (= P202), S205 (= S206), T206 (= T207), V227 (≠ I228), G228 (= G229), R229 (= R230), H276 (= H277), A278 (= A279)
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
44% identity, 79% coverage: 64:314/317 of query aligns to 58:312/317 of 5v7gA
- active site: L94 (≠ N100), R228 (= R230), D252 (= D254), E257 (= E259), H275 (= H277)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V70 (≠ A76), V98 (= V104), F146 (≠ L147), L148 (= L149), G149 (= G150), R150 (≠ A151), I151 (≠ V152), T170 (≠ N172), R171 (= R173), V199 (≠ T201), P200 (= P202), S204 (= S206), T205 (= T207), V226 (≠ I228), G227 (= G229), R228 (= R230), H275 (= H277), A277 (= A279)
- binding oxalate ion: G69 (= G75), V70 (≠ A76), G71 (= G77), R228 (= R230), H275 (= H277)
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
44% identity, 79% coverage: 64:314/317 of query aligns to 60:314/319 of 5v6qB
- active site: L96 (≠ N100), R230 (= R230), D254 (= D254), E259 (= E259), H277 (= H277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V72 (≠ A76), V100 (= V104), F148 (≠ L147), L150 (= L149), G151 (= G150), R152 (≠ A151), I153 (≠ V152), T172 (≠ N172), R173 (= R173), V201 (≠ T201), P202 (= P202), S206 (= S206), T207 (= T207), V228 (≠ I228), G229 (= G229), R230 (= R230), H277 (= H277), A279 (= A279)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
38% identity, 75% coverage: 66:303/317 of query aligns to 66:314/334 of 5aovA
- active site: L100 (≠ N100), R241 (= R230), D265 (= D254), E270 (= E259), H288 (= H277)
- binding glyoxylic acid: Y74 (≠ I74), A75 (≠ G75), V76 (≠ A76), G77 (= G77), R241 (= R230), H288 (= H277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A76), T104 (≠ V104), F158 (≠ L149), G159 (= G150), R160 (≠ A151), I161 (≠ V152), S180 (≠ N172), R181 (= R173), A211 (= A200), V212 (≠ T201), P213 (= P202), T218 (= T207), I239 (= I228), A240 (≠ G229), R241 (= R230), H288 (= H277), G290 (≠ A279)
Sites not aligning to the query:
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
38% identity, 77% coverage: 60:303/317 of query aligns to 59:313/332 of 6biiA
- active site: L99 (≠ N100), R240 (= R230), D264 (= D254), E269 (= E259), H287 (= H277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ A76), T103 (≠ V104), G156 (= G148), F157 (≠ L149), G158 (= G150), R159 (≠ A151), I160 (≠ V152), A179 (≠ N172), R180 (= R173), S181 (≠ Q174), K183 (≠ R176), V211 (≠ T201), P212 (= P202), E216 (≠ S206), T217 (= T207), V238 (≠ I228), A239 (≠ G229), R240 (= R230), D264 (= D254), H287 (= H277), G289 (≠ A279)
2w2lA Crystal structure of the holo forms of rhodotorula graminis d- mandelate dehydrogenase at 2.5a.
33% identity, 79% coverage: 59:309/317 of query aligns to 71:337/346 of 2w2lA
- active site: G113 (≠ N100), R257 (= R230), D281 (= D254), E286 (= E259), H304 (= H277)
- binding nicotinamide-adenine-dinucleotide: T117 (≠ V104), G172 (= G150), A173 (= A151), I174 (≠ V152), D194 (≠ N172), V228 (≠ T201), P229 (= P202), T234 (= T207), T255 (≠ I228), A256 (≠ G229), R257 (= R230), H304 (= H277), G306 (≠ A279), G307 (= G280)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
40% identity, 75% coverage: 66:303/317 of query aligns to 66:314/334 of O58320
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
40% identity, 75% coverage: 66:303/317 of query aligns to 66:314/333 of 2dbqA
- active site: L100 (≠ N100), R241 (= R230), D265 (= D254), E270 (= E259), H288 (= H277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A76), T104 (≠ V104), L158 (= L149), G159 (= G150), R160 (≠ A151), I161 (≠ V152), S180 (≠ N172), R181 (= R173), T182 (≠ Q174), A211 (= A200), V212 (≠ T201), P213 (= P202), T218 (= T207), I239 (= I228), A240 (≠ G229), R241 (= R230), D265 (= D254), H288 (= H277), G290 (≠ A279)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
30% identity, 85% coverage: 37:306/317 of query aligns to 39:312/533 of O43175
- T78 (≠ A76) binding
- R135 (vs. gap) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ AV 151:152) binding
- D175 (≠ N172) binding
- T207 (= T201) binding
- CAR 234:236 (≠ IGR 228:230) binding
- D260 (= D254) binding
- V261 (= V255) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HVAG 277:280) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
31% identity, 84% coverage: 37:303/317 of query aligns to 35:305/305 of 6plfA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
30% identity, 83% coverage: 37:300/317 of query aligns to 34:301/303 of 6plgA
7dkmA Phgdh covalently linked to oridonin (see paper)
30% identity, 83% coverage: 37:300/317 of query aligns to 35:302/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ A76), A102 (≠ V104), G148 (= G148), R151 (≠ A151), I152 (≠ V152), Y170 (≠ H171), D171 (≠ N172), P172 (≠ R173), I173 (≠ Q174), H202 (≠ A200), T203 (= T201), P204 (= P202), T209 (= T207), C230 (≠ I228), A231 (≠ G229), R232 (= R230), H279 (= H277), G281 (≠ A279)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (≠ Q291)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
30% identity, 83% coverage: 37:300/317 of query aligns to 31:298/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G150), I148 (≠ V152), Y166 (≠ H171), D167 (≠ N172), P168 (≠ R173), I169 (≠ Q174), I170 (≠ P175), H198 (≠ A200), T199 (= T201), L208 (= L210), R228 (= R230)
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
30% identity, 83% coverage: 37:300/317 of query aligns to 34:301/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (= L147), G147 (= G148), L148 (= L149), G149 (= G150), R150 (≠ A151), I151 (≠ V152), G152 (= G153), D170 (≠ N172), H201 (≠ A200), T202 (= T201), P203 (= P202)
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
30% identity, 83% coverage: 37:300/317 of query aligns to 34:301/301 of 6rj5A
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
30% identity, 83% coverage: 37:300/317 of query aligns to 34:301/302 of 6rihA
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
31% identity, 83% coverage: 37:299/317 of query aligns to 33:299/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N100), A100 (≠ V104), R149 (≠ A151), I150 (≠ V152), Y168 (≠ H171), D169 (≠ N172), P170 (≠ R173), I171 (≠ Q174), H200 (≠ A200), T201 (= T201), P202 (= P202), T207 (= T207), C228 (≠ I228), A229 (≠ G229), R230 (= R230), H277 (= H277), G279 (≠ A279)
Query Sequence
>GFF2935 FitnessBrowser__WCS417:GFF2935
MTATVLVLVETINEYLPIIEGNDFHVILAPTPAERAEAIKAHGSQIKAVLTRGPLGLYAE
EIAALPQLEIICVIGAGYEHVDLQAASNRGIVVTNGAGVNAPSVADHAMALLLSLVRGIP
QTDVAVRRGEWPKVMRPSLGGKQLGILGLGAVGLEIAKRASQGFGMEVSYHNRQPRDDVD
YTYCATAVELARTSDFLILATPGGASTRHLIDRHALDALGPNGYLVNIGRGSVVVTADLV
AALEQRRIGGAALDVFDDEPQVPDALKKLSNTVLTSHVAGLSPEAAHDTVQRVADNLVEY
FAGRPVLTPVALPPPTK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory