SitesBLAST
Comparing GFF2946 FitnessBrowser__Marino:GFF2946 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6l0uB Crystal structure of mouse glyoxalase i complexed with a small molecule inhibitor
61% identity, 92% coverage: 8:175/182 of query aligns to 1:173/177 of 6l0uB
- active site: Q27 (= Q26), E93 (= E95), H120 (= H122), E166 (= E168)
- binding N-[4-(trifluoromethyloxy)phenyl]-1,3,4,9-tetrahydropyrido[3,4-b]indole-2-carbothioamide: R116 (≠ Q118), K144 (= K146), D148 (= D150), G149 (= G151), W164 (= W166)
- binding zinc ion: Q27 (= Q26), E93 (= E95), H120 (= H122), E166 (= E168)
4kykB Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
61% identity, 92% coverage: 8:175/182 of query aligns to 1:173/177 of 4kykB
- active site: Q27 (= Q26), E93 (= E95), H120 (= H122), E166 (= E168)
- binding indomethacin: K144 (= K146), K150 (= K152), M151 (= M153), L154 (= L156), F156 (= F158)
- binding zinc ion: Q27 (= Q26), E93 (= E95), H120 (= H122), E166 (= E168)
Q9CPU0 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Mus musculus (Mouse) (see paper)
61% identity, 92% coverage: 8:175/182 of query aligns to 8:180/184 of Q9CPU0
- Q34 (= Q26) binding
- E100 (= E95) binding
- H127 (= H122) binding in other chain
- E173 (= E168) binding in other chain
4kykA Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
61% identity, 92% coverage: 8:175/182 of query aligns to 3:175/179 of 4kykA
4kyhA Crystal structure of mouse glyoxalase i complexed with zopolrestat (see paper)
61% identity, 92% coverage: 8:175/182 of query aligns to 3:175/177 of 4kyhA
- active site: Q29 (= Q26), E95 (= E95), H122 (= H122), E168 (= E168)
- binding zinc ion: Q29 (= Q26), E95 (= E95), H122 (= H122), E168 (= E168)
- binding 3,4-dihydro-4-oxo-3-((5-trifluoromethyl-2-benzothiazolyl)methyl)-1-phthalazine acetic acid: M31 (= M28), R33 (= R30), F63 (= F60), E95 (= E95), T97 (= T97), N99 (= N99)
2za0A Crystal structure of mouse glyoxalase i complexed with methyl-gerfelin (see paper)
61% identity, 92% coverage: 8:175/182 of query aligns to 5:177/180 of 2za0A
- active site: Q31 (= Q26), E97 (= E95), H124 (= H122), E170 (= E168)
- binding methyl 4-(2,3-dihydroxy-5-methylphenoxy)-2-hydroxy-6-methylbenzoate: Q31 (= Q26), F65 (= F60), L67 (= L62), F90 (= F88), E97 (= E95), H124 (= H122), M155 (= M153), E170 (= E168)
- binding zinc ion: Q31 (= Q26), E97 (= E95), H124 (= H122), E170 (= E168)
4pv5A Crystal structure of mouse glyoxalase i in complexed with 18-beta- glycyrrhetinic acid (see paper)
62% identity, 93% coverage: 6:175/182 of query aligns to 2:168/170 of 4pv5A
4opnA Crystal structure of mouse glyoxalase i complexed with mah
61% identity, 91% coverage: 10:175/182 of query aligns to 2:172/172 of 4opnA
- active site: Q26 (= Q26), E92 (= E95), H119 (= H122), E165 (= E168)
- binding L-gamma-glutamyl-N-(3-ethynylphenyl)-N-hydroxy-L-glutaminylglycine: Q26 (= Q26), R30 (= R30), F60 (= F60), F85 (= F88), E92 (= E95), T94 (= T97), N96 (= N99), R115 (≠ Q118), H119 (= H122), K143 (= K146), K149 (= K152), M150 (= M153), L153 (= L156), E165 (= E168), I172 (≠ L175)
- binding zinc ion: Q26 (= Q26), E92 (= E95)
4x2aA Crystal structure of mouse glyoxalase i complexed with baicalein (see paper)
65% identity, 87% coverage: 17:175/182 of query aligns to 11:166/167 of 4x2aA
- active site: Q20 (= Q26), E86 (= E95), H113 (= H122), E159 (= E168)
- binding 5,6,7-trihydroxy-2-phenyl-4H-chromen-4-one: Q20 (= Q26), F49 (= F55), L56 (= L62), F79 (= F88), E86 (= E95), H113 (= H122), M144 (= M153), E159 (= E168), I166 (≠ L175)
- binding zinc ion: Q20 (= Q26), E86 (= E95), H113 (= H122), E159 (= E168)
Sites not aligning to the query:
3w0uA Human glyoxalase i with an n-hydroxypyridone inhibitor
59% identity, 93% coverage: 6:175/182 of query aligns to 6:172/175 of 3w0uA
- active site: Q26 (= Q26), E92 (= E95), H119 (= H122), E165 (= E168)
- binding N-[3-(1-Hydroxy-6-oxo-4-phenyl-1,6-dihydro-pyridin-2-yl)-5-methanesulfonylamino-phenyl]-methanesulfonamide: Q26 (= Q26), F60 (= F60), L62 (= L62), E92 (= E95), H119 (= H122), K143 (= K146), M150 (= M153), E165 (= E168), M172 (≠ L175)
- binding zinc ion: Q26 (= Q26), E92 (= E95), H119 (= H122), E165 (= E168)
3w0tA Human glyoxalase i with an n-hydroxypyridone derivative inhibitor
59% identity, 93% coverage: 6:175/182 of query aligns to 6:172/176 of 3w0tA
- active site: Q26 (= Q26), E92 (= E95), H119 (= H122), E165 (= E168)
- binding N-[3-(1-hydroxy-6-oxo-4-phenyl-1,6-dihydropyridin-2-yl)phenyl]methanesulfonamide: Q26 (= Q26), F55 (= F55), F60 (= F60), L62 (= L62), F64 (= F64), E92 (= E95), H119 (= H122), E165 (= E168), M172 (≠ L175)
- binding zinc ion: Q26 (= Q26), E92 (= E95), H119 (= H122), E165 (= E168)
Sites not aligning to the query:
3vw9A Human glyoxalase i with an n-hydroxypyridone inhibitor (see paper)
59% identity, 93% coverage: 6:175/182 of query aligns to 6:172/176 of 3vw9A
- active site: Q26 (= Q26), E92 (= E95), H119 (= H122), E165 (= E168)
- binding 1-hydroxy-6-[1-(3-methoxypropyl)-1H-pyrrolo[2,3-b]pyridin-5-yl]-4-phenylpyridin-2(1H)-one: Q26 (= Q26), C53 (≠ L53), L62 (= L62), E92 (= E95), H119 (= H122), M150 (= M153), F155 (= F158), E165 (= E168), M172 (≠ L175)
- binding zinc ion: Q26 (= Q26), E92 (= E95), H119 (= H122), E165 (= E168)
Sites not aligning to the query:
1qipA Human glyoxalase i complexed with s-p- nitrobenzyloxycarbonylglutathione (see paper)
59% identity, 93% coverage: 6:175/182 of query aligns to 6:172/176 of 1qipA
- active site: Q26 (= Q26), E92 (= E95), H119 (= H122), E165 (= E168)
- binding s-p-nitrobenzyloxycarbonylglutathione: R30 (= R30), Q51 (≠ R51), C53 (≠ L53), F60 (= F60), F64 (= F64), I81 (≠ T84), L85 (≠ F88), T94 (= T97), N96 (= N99), R115 (≠ Q118), M150 (= M153), F155 (= F158), M172 (≠ L175)
- binding zinc ion: Q26 (= Q26), E92 (= E95), H119 (= H122), E165 (= E168)
1qinA Human glyoxalase i complexed with s-(n-hydroxy-n-p- iodophenylcarbamoyl) glutathione (see paper)
59% identity, 93% coverage: 6:175/182 of query aligns to 6:172/176 of 1qinA
- active site: Q26 (= Q26), E92 (= E95), H119 (= H122), E165 (= E168)
- binding s-(n-hydroxy-n-iodophenylcarbamoyl)glutathione: Q26 (= Q26), R30 (= R30), F60 (= F60), L62 (= L62), F64 (= F64), E92 (= E95), T94 (= T97), N96 (= N99), R115 (≠ Q118), H119 (= H122), K143 (= K146), G148 (= G151), K149 (= K152), M150 (= M153), E165 (= E168), M172 (≠ L175)
- binding zinc ion: Q26 (= Q26), E92 (= E95)
1froA Human glyoxalase i with benzyl-glutathione inhibitor (see paper)
59% identity, 93% coverage: 6:175/182 of query aligns to 6:172/176 of 1froA
- active site: Q26 (= Q26), E92 (= E95), H119 (= H122), E165 (= E168)
- binding s-benzyl-glutathione: R30 (= R30), F60 (= F60), T94 (= T97), N96 (= N99), R115 (≠ Q118), M150 (= M153), F155 (= F158), E165 (= E168)
- binding zinc ion: Q26 (= Q26), E92 (= E95), H119 (= H122), E165 (= E168)
Sites not aligning to the query:
Q04760 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Homo sapiens (Human) (see 12 papers)
59% identity, 93% coverage: 6:175/182 of query aligns to 14:180/184 of Q04760
- C19 (≠ L11) modified: Disulfide link with 20; to Y: in dbSNP:rs17855424; mutation to A: No effect on NO-mediated modification. Impaired NO-mediated modification; when associated with A-20. Loss of NO-mediated modification; when associated with A-139.
- C20 (≠ Y12) modified: Disulfide link with 19; mutation to A: No effect on NO-mediated modification. Impaired NO-mediated modification; when associated with A-19. Loss of NO-mediated modification; when associated with A-139.
- Q34 (= Q26) binding ; mutation to E: Reduces enzyme activity by 99%.
- S45 (= S37) mutation to A: No effect on phosphorylation.
- C61 (≠ L53) modified: Disulfide link with 139, Alternate; mutation to A: No effect on NO-mediated modification.
- S69 (≠ T61) mutation to A: No effect on phosphorylation.
- S94 (≠ G89) mutation to A: No effect on phosphorylation.
- T98 (≠ M93) mutation to A: No effect on phosphorylation.
- E100 (= E95) binding ; mutation to Q: Reduces enzyme activity by over 99%.
- T102 (= T97) mutation to A: No effect on phosphorylation.
- T107 (= T102) modified: Phosphothreonine; mutation to A: Loss of phosphorylation.
- E111 (≠ N106) to A: in dbSNP:rs4746
- H127 (= H122) binding in other chain
- C139 (= C134) modified: S-glutathionyl cysteine; alternate; modified: Disulfide link with 61, Alternate; mutation to A: Impaired NO-mediated modification. Loss of NO-mediated modification; when associated with A-19 or A-20.
- E173 (= E168) active site, Proton donor/acceptor; binding in other chain; mutation to Q: Abolishes enzyme activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
7wt0A Human glyoxalase i (with c-ter his tag) in complex with tlsc702 (see paper)
59% identity, 93% coverage: 6:175/182 of query aligns to 13:179/185 of 7wt0A
- binding (~{E})-3-(1,3-benzothiazol-2-yl)-4-(4-methoxyphenyl)but-3-enoic acid: C60 (≠ L53), F62 (= F55), L69 (= L62), F71 (= F64), L92 (≠ F88), E99 (= E95), H126 (= H122), K150 (= K146), M157 (= M153), L160 (= L156), F162 (= F158), E172 (= E168), M179 (≠ L175)
- binding zinc ion: Q33 (= Q26), E99 (= E95), H126 (= H122), E172 (= E168)
Sites not aligning to the query:
7wszA Human glyoxalase i (with c-ter his tag) in glycerol-bound form (see paper)
59% identity, 93% coverage: 6:175/182 of query aligns to 6:172/183 of 7wszA
Sites not aligning to the query:
1bh5A Human glyoxalase i q33e, e172q double mutant (see paper)
58% identity, 93% coverage: 6:175/182 of query aligns to 7:173/177 of 1bh5A
- active site: E27 (≠ Q26), E93 (= E95), H120 (= H122), Q166 (≠ E168)
- binding s-hexylglutathione: R31 (= R30), F61 (= F60), L63 (= L62), T95 (= T97), N97 (= N99), R116 (≠ Q118), M151 (= M153), F156 (= F158)
- binding zinc ion: E27 (≠ Q26), E93 (= E95), H120 (= H122), Q166 (≠ E168)
P50107 Glyoxalase I; Glx I; Aldoketomutase; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; actoylglutathione lyase; EC 4.4.1.5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
49% identity, 82% coverage: 21:170/182 of query aligns to 180:320/326 of P50107
- E318 (= E168) active site, Proton donor/acceptor
Sites not aligning to the query:
- 163 active site, Proton donor/acceptor
Query Sequence
>GFF2946 FitnessBrowser__Marino:GFF2946
MPKHFEQAPGLYEETVPETEGYVFNQTMMRIKEPERSMDFYTRVMGMRLVRKLDFPEMKF
TLYFLGYLDDRQAGLVPQDDAHRTTYTFGREAMLELTHNWGTEDDNDFGYHNGNDEPQGF
GHIGVAVPDVYAACDRFQKLGVEFVKKPDDGKMKGLAFIKDPDGYWIEILQPDMLEKQRK
ED
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory