SitesBLAST
Comparing GFF2963 FitnessBrowser__WCS417:GFF2963 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5yaqB Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with scyllo-inosose (see paper)
47% identity, 94% coverage: 4:352/371 of query aligns to 2:350/366 of 5yaqB
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K100 (= K103), Y129 (= Y132), Y157 (≠ F160), E159 (= E162), R172 (= R175), D185 (= D187), H189 (= H191)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), T9 (= T11), G10 (= G12), F11 (= F13), M12 (= M14), D39 (= D42), M40 (≠ A43), T76 (= T79), T77 (= T80), N79 (= N82), H82 (= H85), E99 (= E102), K100 (= K103), N128 (= N131), R172 (= R175), H189 (= H191)
5ya8A Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with myo-inositol (see paper)
47% identity, 94% coverage: 4:352/371 of query aligns to 2:350/366 of 5ya8A
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K100 (= K103), Y129 (= Y132), Y157 (≠ F160), E159 (= E162), R172 (= R175), D185 (= D187), H189 (= H191)
- binding nicotinamide-adenine-dinucleotide: T9 (= T11), G10 (= G12), F11 (= F13), M12 (= M14), D39 (= D42), M40 (≠ A43), T76 (= T79), T77 (= T80), P78 (= P81), N79 (= N82), H82 (= H85), E99 (= E102), K100 (= K103), N128 (= N131), H189 (= H191)
6ktkC Crystal structure of scyllo-inositol dehydrogenase r178a mutant, complexed with nadh and l-glucono-1,5-lactone, from paracoccus laeviglucosivorans (see paper)
46% identity, 95% coverage: 2:352/371 of query aligns to 1:351/368 of 6ktkC
- binding L-glucono-1,5-lactone: K101 (= K103), Y130 (= Y132), Y158 (≠ F160), E160 (= E162), Y162 (≠ F164), D186 (= D187), H190 (= H191)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T10 (= T11), G11 (= G12), F12 (= F13), M13 (= M14), D40 (= D42), M41 (≠ A43), T77 (= T79), T78 (= T80), N80 (= N82), H83 (= H85), E100 (= E102), K101 (= K103), N129 (= N131), H190 (= H191)
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
40% identity, 98% coverage: 4:368/371 of query aligns to 2:373/378 of 6a3jC
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G12), F11 (= F13), M12 (= M14), E41 (≠ D42), T79 (= T80), P80 (= P81), N81 (= N82), H84 (= H85), E101 (= E102), K102 (= K103), W173 (= W174), R174 (= R175)
- binding alpha-L-sorbopyranose: K102 (= K103), Y131 (= Y132), Y159 (≠ F160), Q161 (≠ E162), W163 (≠ F164), R174 (= R175), D187 (= D187)
F0M433 Levoglucosan dehydrogenase; LGDH; 1,6-anhydro-beta-D-glucose dehydrogenase; PpLGDH; EC 1.1.1.425 from Pseudarthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LMG 23796 / Sphe3) (Arthrobacter phenanthrenivorans) (see paper)
39% identity, 99% coverage: 1:368/371 of query aligns to 1:385/390 of F0M433
- F13 (= F13) binding
- M14 (= M14) binding
- E43 (≠ D42) binding
- T81 (= T80) binding
- N83 (= N82) binding
- H86 (= H85) binding
- E103 (= E102) binding
- K104 (= K103) binding ; binding
- A130 (≠ G129) binding
- N132 (= N131) binding
- Y133 (= Y132) binding
- Q163 (≠ E162) binding
- W175 (= W174) binding
- R176 (= R175) binding ; binding
- D189 (= D187) binding
- H193 (= H191) binding
- Y335 (= Y318) binding
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
40% identity, 99% coverage: 2:368/371 of query aligns to 1:369/372 of 6a3iA
- binding Levoglucosan: K103 (= K103), Y132 (= Y132), Y160 (≠ F160), Q162 (≠ E162), R175 (= R175), D188 (= D187), H192 (= H191)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F12 (= F13), M13 (= M14), E42 (≠ D42), A43 (= A43), P81 (= P81), N82 (= N82), L84 (= L84), H85 (= H85), E102 (= E102), K103 (= K103), W174 (= W174), R175 (= R175)
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
33% identity, 73% coverage: 6:276/371 of query aligns to 4:252/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G12), F11 (= F13), M12 (= M14), D33 (= D42), L34 (≠ A43), T70 (= T79), T71 (= T80), P72 (= P81), N73 (= N82), L75 (= L84), H76 (= H85), Q79 (≠ M88), E93 (= E102), K94 (= K103), N122 (= N131), W161 (= W174), H179 (= H191)
Sites not aligning to the query:
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
33% identity, 73% coverage: 6:276/371 of query aligns to 4:252/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (= F13), F152 (≠ M165), N154 (≠ D167), D175 (= D187), L176 (= L188), H179 (= H191), E236 (≠ N260)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G12), F11 (= F13), M12 (= M14), D33 (= D42), L34 (≠ A43), T70 (= T79), T71 (= T80), P72 (= P81), N73 (= N82), L75 (= L84), H76 (= H85), Q79 (≠ M88), E93 (= E102), K94 (= K103), N122 (= N131), W161 (= W174), H179 (= H191)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
33% identity, 73% coverage: 6:276/371 of query aligns to 4:252/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (= F13), N154 (≠ D167), D175 (= D187), H179 (= H191), E236 (≠ N260)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G10), G10 (= G12), F11 (= F13), M12 (= M14), D33 (= D42), L34 (≠ A43), T70 (= T79), T71 (= T80), P72 (= P81), N73 (= N82), L75 (= L84), H76 (= H85), Q79 (≠ M88), E93 (= E102), K94 (= K103), N122 (= N131), W161 (= W174)
Sites not aligning to the query:
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
29% identity, 74% coverage: 2:276/371 of query aligns to 1:262/340 of 1evjA
- active site: K100 (= K103), Y188 (≠ H191)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), L10 (≠ T11), G11 (= G12), K12 (≠ A19), Y13 (≠ L20), D35 (= D42), L77 (≠ T80), P78 (= P81), N79 (= N82), H82 (= H85), E99 (= E102), K100 (= K103), R128 (≠ N131), W170 (= W174), R171 (= R175), Y188 (≠ H191)
Sites not aligning to the query:
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
26% identity, 99% coverage: 2:369/371 of query aligns to 30:372/381 of 1rydA
- active site: K129 (= K103), Y217 (≠ H191)
- binding alpha-D-glucopyranose: Y236 (≠ P218), I254 (≠ H236), Q256 (≠ L238)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (≠ T11), G40 (= G12), K41 (≠ A19), Y42 (≠ L20), S64 (≠ D42), G65 (≠ A43), K69 (≠ R47), Y87 (≠ H61), L106 (≠ T80), P107 (= P81), N108 (= N82), L110 (= L84), H111 (= H85), E128 (= E102), K129 (= K103), R157 (≠ N131), A196 (≠ P171), W199 (= W174), R200 (= R175), Y217 (≠ H191), Y296 (≠ F293)
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
26% identity, 99% coverage: 2:369/371 of query aligns to 32:374/383 of 1h6dA
- active site: K131 (= K103), Y219 (≠ H191)
- binding glycerol: K131 (= K103), R202 (= R175), D215 (= D187), Y219 (≠ H191)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G40 (= G10), L41 (≠ T11), G42 (= G12), K43 (≠ A19), Y44 (≠ L20), S66 (≠ D42), G67 (≠ A43), K71 (≠ R47), Y89 (≠ H61), I107 (≠ T79), L108 (≠ T80), P109 (= P81), N110 (= N82), H113 (= H85), E130 (= E102), K131 (= K103), R159 (≠ N131), A198 (≠ P171), W201 (= W174), R202 (= R175), Y219 (≠ H191), Y298 (≠ F293)
Sites not aligning to the query:
7d5nA Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
30% identity, 57% coverage: 73:283/371 of query aligns to 84:282/379 of 7d5nA
Sites not aligning to the query:
3dtyA Crystal structure of an oxidoreductase from pseudomonas syringae
30% identity, 59% coverage: 73:290/371 of query aligns to 80:276/374 of 3dtyA
7d5nB Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
30% identity, 57% coverage: 73:283/371 of query aligns to 84:291/389 of 7d5nB
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K114 (= K103), Y143 (= Y132), R190 (= R175), D204 (= D187), H208 (= H191)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T91 (= T80), P92 (= P81), N93 (= N82), H96 (= H85), E113 (= E102), K114 (= K103), W189 (= W174), R190 (= R175), H208 (= H191)
Sites not aligning to the query:
7d5mA Crystal structure of inositol dehydrogenase homolog complexed with NAD+ from azotobacter vinelandii
30% identity, 57% coverage: 73:283/371 of query aligns to 85:292/389 of 7d5mA
Sites not aligning to the query:
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
27% identity, 83% coverage: 2:310/371 of query aligns to 1:285/335 of 5a05A
- active site: K100 (= K103), Y185 (≠ H191)
- binding beta-D-glucopyranose: K100 (= K103), F159 (≠ A166), D181 (= D187), Y185 (≠ H191)
- binding alpha-D-glucopyranose: P259 (≠ Q277), S262 (≠ L280)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G10), L10 (≠ T11), G11 (= G12), Y12 (≠ F13), Y13 (≠ H18), S35 (≠ D42), G36 (≠ A43), T37 (≠ D44), K40 (≠ R47), Y58 (vs. gap), I76 (≠ T79), T77 (= T80), P78 (= P81), N79 (= N82), L81 (= L84), H82 (= H85), E99 (= E102), K100 (= K103), R128 (≠ N131), W167 (= W174), R168 (= R175), Y185 (≠ H191), Y263 (≠ N281)
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
27% identity, 83% coverage: 2:310/371 of query aligns to 1:285/335 of 5a04A
- active site: K100 (= K103), Y185 (≠ H191)
- binding beta-D-glucopyranose: K100 (= K103), F159 (≠ A166), R168 (= R175), D181 (= D187), Y185 (≠ H191)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (≠ T11), G11 (= G12), Y12 (≠ F13), Y13 (≠ H18), S35 (≠ D42), G36 (≠ A43), T37 (≠ D44), K40 (≠ R47), Y58 (vs. gap), I76 (≠ T79), T77 (= T80), P78 (= P81), N79 (= N82), L81 (= L84), H82 (= H85), E99 (= E102), K100 (= K103), R128 (≠ N131), W167 (= W174), R168 (= R175), Y185 (≠ H191), Y263 (≠ N281)
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
27% identity, 83% coverage: 2:310/371 of query aligns to 1:285/335 of 5a03E
- active site: K100 (= K103), Y185 (≠ H191)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G10), L10 (≠ T11), G11 (= G12), Y12 (≠ F13), Y13 (≠ H18), S35 (≠ D42), G36 (≠ A43), T37 (≠ D44), K40 (≠ R47), Y58 (vs. gap), I76 (≠ T79), T77 (= T80), P78 (= P81), N79 (= N82), H82 (= H85), E99 (= E102), K100 (= K103), R128 (≠ N131), W167 (= W174), R168 (= R175), Y185 (≠ H191), Y263 (≠ N281)
- binding beta-D-xylopyranose: K100 (= K103), F159 (≠ A166), R168 (= R175), D181 (= D187), Y185 (≠ H191), E205 (≠ Q211), T207 (≠ V213), R209 (≠ A215)
- binding alpha-D-xylopyranose: H134 (≠ M137), M268 (≠ C286), R279 (≠ G304), E280 (≠ Y305)
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
27% identity, 83% coverage: 2:310/371 of query aligns to 1:285/335 of 5a02A
- active site: K100 (= K103), Y185 (≠ H191)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L10 (≠ T11), G11 (= G12), Y12 (≠ F13), Y13 (≠ H18), S35 (≠ D42), G36 (≠ A43), T37 (≠ D44), K40 (≠ R47), Y58 (vs. gap), I76 (≠ T79), T77 (= T80), P78 (= P81), L81 (= L84), H82 (= H85), E99 (= E102), K100 (= K103), R128 (≠ N131), W167 (= W174), R168 (= R175), Y185 (≠ H191), Y263 (≠ N281)
Query Sequence
>GFF2963 FitnessBrowser__WCS417:GFF2963
MRELGIGLIGTGFMGRAHALAFNNARAVFELPVHLKLAALADADTERAQRCAKAWGFAQA
HGDWQALINDPNVDVVAITTPNHLHYPMAMAAIAAGKAVYCEKPLAVSLEQADAMRRAAS
AAGVVTRVGYNYQHNPMITLARQMIAGGELGEIISFQGEFSEDFMADSASPWSWRCEVEH
AGGALADLGSHLLSMARYLLGDVVSVCADTQTVHARRPAINGSAQLKPIAVDDQVHALLR
FANGARGTVSSSWLKHGYKNHLSFEISGTKGTLAFDQERLNELQVCRVGQDGFQRVLAGP
ALPGYAAFSPAAGHQLGYNELKTLEVQELIMAIAGQGADGTDFEAAWEVERLATAIRVAA
LEERWVTVNAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory