Comparing GFF2974 FitnessBrowser__Marino:GFF2974 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
46% identity, 90% coverage: 25:250/252 of query aligns to 3:226/226 of 8eyzA
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
44% identity, 88% coverage: 26:246/252 of query aligns to 5:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
44% identity, 88% coverage: 26:246/252 of query aligns to 5:226/226 of 4zv1A
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
37% identity, 85% coverage: 31:245/252 of query aligns to 20:234/235 of 4g4pA
4zefA Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
36% identity, 87% coverage: 21:240/252 of query aligns to 12:231/239 of 4zefA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
36% identity, 87% coverage: 26:245/252 of query aligns to 11:228/229 of 5t0wA
2pyyB Crystal structure of the glur0 ligand-binding core from nostoc punctiforme in complex with (l)-glutamate (see paper)
38% identity, 79% coverage: 50:247/252 of query aligns to 19:212/217 of 2pyyB
Sites not aligning to the query:
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
38% identity, 84% coverage: 35:245/252 of query aligns to 20:227/229 of 6svfA
4kqpA Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in complex with glutamine at 0.95 a resolution (see paper)
31% identity, 90% coverage: 20:245/252 of query aligns to 1:226/230 of 4kqpA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
34% identity, 85% coverage: 31:245/252 of query aligns to 7:222/224 of 4ymxA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
31% identity, 92% coverage: 20:250/252 of query aligns to 6:235/241 of 2q2aA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
33% identity, 87% coverage: 27:245/252 of query aligns to 6:226/234 of 3k4uE
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
32% identity, 88% coverage: 29:250/252 of query aligns to 9:229/235 of 2pvuA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
32% identity, 88% coverage: 29:250/252 of query aligns to 5:225/231 of 2q2cA
8b5dA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
33% identity, 87% coverage: 26:244/252 of query aligns to 1:219/223 of 8b5dA
6fxgB Crystal structure of substrate binding domain 1 (sbd1) of abc transporter glnpq in complex with asparagine
32% identity, 87% coverage: 26:244/252 of query aligns to 4:222/226 of 6fxgB
8b5eA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
32% identity, 87% coverage: 26:244/252 of query aligns to 3:221/225 of 8b5eA
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
31% identity, 86% coverage: 27:243/252 of query aligns to 13:233/240 of 4h5fA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
30% identity, 90% coverage: 20:245/252 of query aligns to 1:227/228 of 2y7iA
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
28% identity, 87% coverage: 27:245/252 of query aligns to 10:231/237 of 4i62A
>GFF2974 FitnessBrowser__Marino:GFF2974
MSTKWLKTVSASLALTVAAGTVSAETLRVVTDPSFVPFEMMDQETGEMIGFDMEIIREVA
DRAGFEIDLNTMDFNGIIPALQTGNVDIAIAGITITEEREEIVDFSDPYYDSGLRILVRE
GNDDVSEFDDLEGKKIGTKIGSTSYDYLVKNLDADDGVTPYPGSSDMYMALMSRAIDAVF
YDAPNVGYFARTKGEGKVTTVGPLYEGQQYGIALKSGSEWVDDVNEALAAMKEDGTYKTI
YEKWFGPMPEGM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory