SitesBLAST
Comparing GFF2987 HP15_2931 glycerate dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
36% identity, 85% coverage: 45:316/320 of query aligns to 37:308/334 of 5aovA
- active site: L100 (≠ G107), R241 (= R246), D265 (= D270), E270 (= E275), H288 (= H296)
- binding glyoxylic acid: M52 (≠ V57), L53 (= L58), L53 (= L58), Y74 (≠ V81), A75 (= A82), V76 (≠ T83), G77 (= G84), R241 (= R246), H288 (= H296)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ T83), T104 (≠ V111), F158 (≠ Y164), G159 (= G165), R160 (≠ D166), I161 (≠ L167), S180 (≠ A186), R181 (= R187), A211 (≠ H216), V212 (≠ C217), P213 (≠ L218), T218 (= T223), I239 (≠ T244), A240 (≠ S245), R241 (= R246), H288 (= H296), G290 (≠ A298)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
37% identity, 86% coverage: 34:307/320 of query aligns to 20:289/304 of 1wwkA
- active site: S96 (≠ G107), R230 (= R246), D254 (= D270), E259 (= E275), H278 (= H296)
- binding nicotinamide-adenine-dinucleotide: V100 (= V111), G146 (= G163), F147 (≠ Y164), G148 (= G165), R149 (≠ D166), I150 (≠ L167), Y168 (vs. gap), D169 (≠ G185), P170 (≠ A186), V201 (≠ C217), P202 (≠ L218), T207 (= T223), T228 (= T244), S229 (= S245), D254 (= D270), H278 (= H296), G280 (≠ A298)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
37% identity, 84% coverage: 47:316/320 of query aligns to 38:307/332 of 6biiA
- active site: L99 (≠ G107), R240 (= R246), D264 (= D270), E269 (= E275), H287 (= H296)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ T83), T103 (≠ V111), G156 (= G163), F157 (≠ Y164), G158 (= G165), R159 (≠ D166), I160 (≠ L167), A179 (= A186), R180 (= R187), S181 (≠ P188), K183 (≠ Q190), V211 (≠ C217), P212 (≠ L218), E216 (= E222), T217 (= T223), V238 (≠ T244), A239 (≠ S245), R240 (= R246), D264 (= D270), H287 (= H296), G289 (≠ A298)
4lceA Ctbp1 in complex with substrate mtob (see paper)
34% identity, 88% coverage: 40:320/320 of query aligns to 29:325/327 of 4lceA
- active site: S98 (≠ G107), R240 (= R246), D264 (= D270), E269 (= E275), H289 (= H296)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: R71 (≠ V80), G73 (≠ A82), S74 (≠ T83), G75 (= G84), R240 (= R246), H289 (= H296), W292 (= W299)
- binding nicotinamide-adenine-dinucleotide: S74 (≠ T83), T102 (≠ V111), G155 (= G163), G157 (= G165), R158 (≠ D166), V159 (≠ L167), Y177 (≠ Q190), D178 (≠ E191), P179 (= P192), Y180 (≠ G193), H210 (= H216), C211 (= C217), N214 (≠ T220), N217 (≠ T223), T238 (= T244), A239 (≠ S245), R240 (= R246), W292 (= W299)
6v89A Human ctbp1 (28-375) in complex with amp (see paper)
34% identity, 88% coverage: 40:320/320 of query aligns to 30:326/332 of 6v89A
6cdfA Human ctbp1 (28-378) (see paper)
34% identity, 88% coverage: 40:320/320 of query aligns to 31:327/333 of 6cdfA
- binding 1,4-dihydronicotinamide adenine dinucleotide: T104 (≠ V111), G157 (= G163), R160 (≠ D166), V161 (≠ L167), Y179 (≠ Q190), D180 (≠ E191), P181 (= P192), Y182 (≠ G193), H212 (= H216), C213 (= C217), N219 (≠ T223), T240 (= T244), A241 (≠ S245), R242 (= R246), H291 (= H296), W294 (= W299)
1hl3A Ctbp/bars in ternary complex with NAD(h) and pidlskk peptide (see paper)
34% identity, 88% coverage: 40:320/320 of query aligns to 30:326/331 of 1hl3A
- active site: S99 (≠ G107), R241 (= R246), D265 (= D270), E270 (= E275), H290 (= H296)
- binding nicotinamide-adenine-dinucleotide: T103 (≠ V111), G158 (= G165), R159 (≠ D166), V160 (≠ L167), D179 (≠ E191), Y181 (≠ G193), H211 (= H216), C212 (= C217), G213 (≠ L218), N218 (≠ T223), T239 (= T244), A240 (≠ S245), R241 (= R246), D265 (= D270), H290 (= H296)
- binding : E36 (≠ Q46), H38 (≠ L48), E39 (= E49)
Sites not aligning to the query:
1hkuA Ctbp/bars: a dual-function protein involved in transcription corepression and golgi membrane fission (see paper)
34% identity, 88% coverage: 40:320/320 of query aligns to 30:326/331 of 1hkuA
- active site: S99 (≠ G107), R241 (= R246), D265 (= D270), E270 (= E275), H290 (= H296)
- binding nicotinamide-adenine-dinucleotide: S75 (≠ T83), T103 (≠ V111), G156 (= G163), G158 (= G165), R159 (≠ D166), V160 (≠ L167), Y178 (≠ Q190), D179 (≠ E191), P180 (= P192), Y181 (≠ G193), C212 (= C217), N218 (≠ T223), T239 (= T244), A240 (≠ S245), R241 (= R246), H290 (= H296), W293 (= W299)
Sites not aligning to the query:
4u6sA Ctbp1 in complex with substrate phenylpyruvate (see paper)
36% identity, 83% coverage: 40:304/320 of query aligns to 30:298/328 of 4u6sA
- active site: S99 (≠ G107), R241 (= R246), D265 (= D270), E270 (= E275), H290 (= H296)
- binding nicotinamide-adenine-dinucleotide: T103 (≠ V111), G156 (= G163), G158 (= G165), R159 (≠ D166), V160 (≠ L167), Y178 (≠ Q190), D179 (≠ E191), P180 (= P192), Y181 (≠ G193), H211 (= H216), C212 (= C217), G213 (≠ L218), N218 (≠ T223), T239 (= T244), A240 (≠ S245), R241 (= R246), H290 (= H296), W293 (= W299)
- binding 3-phenylpyruvic acid: Y51 (≠ V59), H52 (≠ N60), I73 (≠ V81), G74 (≠ A82), S75 (≠ T83), G76 (= G84), R241 (= R246), W293 (= W299)
Sites not aligning to the query:
4u6qA Ctbp1 bound to inhibitor 2-(hydroxyimino)-3-phenylpropanoic acid (see paper)
36% identity, 83% coverage: 40:304/320 of query aligns to 30:298/328 of 4u6qA
- active site: S99 (≠ G107), R241 (= R246), D265 (= D270), E270 (= E275), H290 (= H296)
- binding (2E)-2-(hydroxyimino)-3-phenylpropanoic acid: Y51 (≠ V59), I73 (≠ V81), G74 (≠ A82), S75 (≠ T83), G76 (= G84), R241 (= R246), H290 (= H296), W293 (= W299)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S75 (≠ T83), T103 (≠ V111), G156 (= G163), R159 (≠ D166), V160 (≠ L167), Y178 (≠ Q190), D179 (≠ E191), P180 (= P192), Y181 (≠ G193), H211 (= H216), C212 (= C217), G213 (≠ L218), N218 (≠ T223), T239 (= T244), A240 (≠ S245), R241 (= R246), H290 (= H296), W293 (= W299)
Sites not aligning to the query:
8atiA Human ctbp2(31-364) in complex with rai2 peptide(315-322)
34% identity, 83% coverage: 40:304/320 of query aligns to 29:297/330 of 8atiA
- binding nicotinamide-adenine-dinucleotide: S74 (≠ T83), T102 (≠ V111), G155 (= G163), G157 (= G165), R158 (≠ D166), T159 (≠ L167), D178 (≠ E191), P179 (= P192), Y180 (≠ G193), H210 (= H216), C211 (= C217), N212 (≠ L218), A238 (≠ T244), R240 (= R246), H289 (= H296), A291 (= A298), W292 (= W299)
- binding : E35 (≠ Q46), H37 (≠ L48)
Sites not aligning to the query:
4lcjA Ctbp2 in complex with substrate mtob (see paper)
34% identity, 83% coverage: 40:304/320 of query aligns to 29:297/330 of 4lcjA
- active site: A98 (≠ G107), R240 (= R246), D264 (= D270), E269 (= E275), H289 (= H296)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: Y50 (≠ V59), H51 (≠ N60), I72 (≠ V81), G73 (≠ A82), S74 (≠ T83), G75 (= G84), R240 (= R246), H289 (= H296), W292 (= W299)
- binding nicotinamide-adenine-dinucleotide: S74 (≠ T83), T102 (≠ V111), I154 (≠ V162), G155 (= G163), G157 (= G165), R158 (≠ D166), T159 (≠ L167), D178 (≠ E191), Y180 (≠ G193), H210 (= H216), C211 (= C217), N212 (≠ L218), N214 (≠ T220), N217 (≠ T223), A238 (≠ T244), A239 (≠ S245), R240 (= R246), H289 (= H296), W292 (= W299)
Q9Z2F5 C-terminal-binding protein 1; CtBP1; 50 kDa BFA-dependent ADP-ribosylation substrate; BARS-50; C-terminal-binding protein 3; CtBP3; EC 1.1.1.- from Rattus norvegicus (Rat) (see 3 papers)
34% identity, 88% coverage: 40:320/320 of query aligns to 44:340/430 of Q9Z2F5
- V55 (≠ I51) mutation to R: Strongly reduces interaction with E1A.
- S89 (≠ T83) binding
- IGLGRV 169:174 (≠ VGYGDL 162:167) binding
- G172 (= G165) mutation to E: Loss dimerization and of NAD binding.
- D193 (≠ E191) binding
- 226:232 (vs. 217:223, 29% identical) binding
- TAR 253:255 (≠ TSR 244:246) binding
- D279 (= D270) binding
Sites not aligning to the query:
- 41 A→E: Strongly reduces interaction with E1A.
Q13363 C-terminal-binding protein 1; CtBP1; EC 1.1.1.- from Homo sapiens (Human) (see 4 papers)
34% identity, 88% coverage: 40:320/320 of query aligns to 55:351/440 of Q13363
- V66 (≠ I51) mutation to R: Loss of interaction with SIMC1. Reduced proteolytic processing mediated by CAPN3.
- C134 (≠ A117) mutation to A: Strongly reduces E1A binding; when associated with A-138; A-141 and A-150.
- N138 (≠ A121) mutation to A: Strongly reduces E1A binding; when associated with A-134; A-141 and A-150.
- R141 (≠ T124) mutation to A: Strongly reduces E1A binding; when associated with A-134; A-138 and A-150.
- RR 141:142 (≠ TR 124:125) mutation to AA: Strongly reduces E1A binding; when associated with A-163 and A-171.
- L150 (≠ V133) mutation to A: Strongly reduces E1A binding; when associated with A-134; A-138 and A-141.
- R163 (≠ C145) mutation to A: Strongly reduces E1A binding; when associated with A-141; A-142 and A-171.
- R171 (≠ E153) mutation to A: Strongly reduces E1A binding; when associated with A-141; A-142 and A-163.
- G181 (= G163) mutation to V: Strongly reduces E1A binding; when associated with V-183 and A-204.
- G183 (= G165) mutation to A: Reduced proteolytic processing mediated by CAPN3; when associated with A-186.; mutation to V: Strongly reduces E1A binding; when associated with V-181 and A-204.
- G186 (= G168) mutation to A: Reduced proteolytic processing mediated by CAPN3; when associated with A-183.
- D204 (≠ E191) mutation to A: Strongly reduces E1A binding; when associated with V-181 and V-183.; mutation to L: Reduced proteolytic processing mediated by CAPN3.
- R266 (= R246) mutation to A: Strongly reduces E1A binding; when associated with A-290; A-295 and A-315.
- D290 (= D270) mutation to A: Strongly reduces E1A binding; when associated with A-266; A-295 and A-315.
- E295 (= E275) mutation to A: Strongly reduces E1A binding; when associated with A-266; A-290 and A-315.
- H315 (= H296) mutation to A: Strongly reduces E1A binding; when associated with A-266; A-290 and A-295.
Sites not aligning to the query:
- 52 A→E: Loss of interaction with SIMC1. No effect on its proteolytic processing mediated by CAPN3.
- 375:376 Cleavage; by CAPN1
- 387:388 Cleavage; by CAPN1
- 409:410 Cleavage; by CAPN1 and CAPN3
- 422 modified: Phosphoserine; by HIPK2; S→A: Abolishes phosphorylation by HIPK2 and prevents UV-induced clearance.
- 428 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)
P56545 C-terminal-binding protein 2; CtBP2 from Homo sapiens (Human)
34% identity, 83% coverage: 40:304/320 of query aligns to 61:329/445 of P56545
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
33% identity, 83% coverage: 43:308/320 of query aligns to 87:356/466 of P87228
- S87 (≠ T43) modified: Phosphoserine
- S258 (≠ T220) modified: Phosphoserine
5z20F The ternary structure of d-lactate dehydrogenase from pseudomonas aeruginosa with nadh and oxamate (see paper)
37% identity, 76% coverage: 76:318/320 of query aligns to 77:324/336 of 5z20F
- active site: S108 (≠ G107), R241 (= R246), D265 (= D270), E270 (= E275), H302 (= H296)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y107 (= Y106), G160 (= G165), Q161 (≠ D166), I162 (≠ L167), Y180 (≠ A186), D181 (≠ R187), P182 (= P188), C212 (= C217), P213 (≠ L218), T218 (= T223), T239 (= T244), G240 (≠ S245), R241 (= R246), H302 (= H296), A304 (= A298)
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
31% identity, 86% coverage: 34:308/320 of query aligns to 21:290/301 of 6rj5A
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
31% identity, 86% coverage: 34:308/320 of query aligns to 21:290/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V162), G147 (= G163), L148 (≠ Y164), G149 (= G165), R150 (≠ D166), I151 (≠ L167), G152 (= G168), D170 (≠ R187), H201 (= H216), T202 (≠ C217), P203 (≠ L218)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
31% identity, 86% coverage: 34:308/320 of query aligns to 21:290/302 of 6rihA
Query Sequence
>GFF2987 HP15_2931 glycerate dehydrogenase
MAIWIQEKSMKAVFLDAKTLGDDVDLSPIESVTGGLEKYDRTTPDQILERIRGFDTVLVN
KVVLTREHFDACPELKTIAVVATGLNNIDQAAAKDHGIKVMNVTNYGRSTVAQHTMALML
ALATRLLDYTRDVQAGHWGKSDMFCLMDHPIMELEGRTLGIVGYGDLGQGVAERAAAFGM
KVLLGARPGQEPGVVDGYSRIPLDELLPQADVVSLHCLLTDETRDLIGARELKMMKPDSL
LINTSRGGLVNEQALADALRAGEIGGAGFDVLTEEPPRNGNPLLADDIPNLIVTPHSAWA
SREARQRIVGITAVNLKSVL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory