SitesBLAST
Comparing GFF2997 FitnessBrowser__Phaeo:GFF2997 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3daaA Crystallographic structure of d-amino acid aminotransferase inactivated by pyridoxyl-d-alanine (see paper)
36% identity, 94% coverage: 8:277/286 of query aligns to 6:272/277 of 3daaA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K150), E177 (= E182), L201 (= L206)
- binding n-(5'-phosphopyridoxyl)-d-alanine: Y31 (= Y33), R50 (= R52), K145 (= K150), E177 (= E182), S180 (= S185), S181 (≠ N186), L201 (= L206), G203 (= G208), I204 (= I209), T205 (= T210), S240 (= S245), T241 (≠ A246)
2daaA Crystallographic structure of d-amino acid aminotransferase inactivated by d-cycloserine
36% identity, 94% coverage: 8:277/286 of query aligns to 6:272/277 of 2daaA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K150), E177 (= E182), L201 (= L206)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Y31 (= Y33), V33 (= V35), R50 (= R52), R98 (= R101), H100 (≠ F103), K145 (= K150), E177 (= E182), S180 (= S185), S181 (≠ N186), N182 (= N187), L201 (= L206), G203 (= G208), I204 (= I209), T205 (= T210), T241 (≠ A246)
1daaA Crystallographic structure of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate (see paper)
36% identity, 94% coverage: 8:277/286 of query aligns to 6:272/277 of 1daaA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K150), E177 (= E182), L201 (= L206)
- binding pyridoxal-5'-phosphate: R50 (= R52), K145 (= K150), E177 (= E182), S180 (= S185), S181 (≠ N186), L201 (= L206), G203 (= G208), I204 (= I209), T205 (= T210), S240 (= S245), T241 (≠ A246)
3lqsA Complex structure of d-amino acid aminotransferase and 4-amino-4,5- dihydro-thiophenecarboxylic acid (adta) (see paper)
36% identity, 94% coverage: 8:277/286 of query aligns to 6:272/280 of 3lqsA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K150), E177 (= E182), L201 (= L206)
- binding 4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]thiophene-2-carboxylic acid: V33 (= V35), R50 (= R52), E177 (= E182), S180 (= S185), S181 (≠ N186), N182 (= N187), L201 (= L206), G203 (= G208), I204 (= I209), T205 (= T210), S240 (= S245), T241 (≠ A246), T242 (≠ S247)
P19938 D-alanine aminotransferase; D-amino acid aminotransferase; D-amino acid transaminase; DAAT; D-aspartate aminotransferase; EC 2.6.1.21 from Bacillus sp. (strain YM-1) (see 5 papers)
36% identity, 94% coverage: 8:277/286 of query aligns to 7:273/283 of P19938
- Y32 (= Y33) binding
- R51 (= R52) binding
- R99 (= R101) binding
- H101 (≠ F103) binding
- K146 (= K150) active site, Proton acceptor; modified: N6-(pyridoxal phosphate)lysine
- E178 (= E182) binding ; mutation to K: Loss of transaminase activity and small gain in racemase activity.
- L202 (= L206) mutation to A: Inactivates enzyme.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1a0gB L201a mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate (see paper)
36% identity, 94% coverage: 8:277/286 of query aligns to 6:272/282 of 1a0gB
- active site: Y31 (= Y33), V33 (= V35), K145 (= K150), E177 (= E182), A201 (≠ L206)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R50 (= R52), K145 (= K150), E177 (= E182), S180 (= S185), S181 (≠ N186), G203 (= G208), I204 (= I209), T205 (= T210), S240 (= S245), T241 (≠ A246)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
34% identity, 99% coverage: 5:286/286 of query aligns to 5:287/290 of 5e25A
- active site: F33 (≠ Y33), G35 (≠ V35), K151 (= K150), E184 (= E182), L207 (= L206)
- binding 2-oxoglutaric acid: Y88 (≠ L88), K151 (= K150), T247 (≠ A246), A248 (≠ S247)
- binding pyridoxal-5'-phosphate: R52 (= R52), K151 (= K150), Y155 (≠ L154), E184 (= E182), G187 (≠ S185), D188 (≠ N186), L207 (= L206), G209 (= G208), I210 (= I209), T211 (= T210), G246 (≠ S245), T247 (≠ A246)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
35% identity, 95% coverage: 5:275/286 of query aligns to 4:275/290 of 5mr0D
- active site: F32 (≠ Y33), G34 (≠ V35), K150 (= K150), E183 (= E182), L206 (= L206)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R52), G100 (≠ D102), L101 (≠ V104), K150 (= K150), Y154 (≠ L154), E183 (= E182), G186 (≠ S185), D187 (≠ N186), L206 (= L206), I209 (= I209), T210 (= T210), G245 (≠ S245), T246 (≠ A246)
7p3tB Transaminase of gamma-proteobacterium (see paper)
33% identity, 95% coverage: 5:277/286 of query aligns to 6:279/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R52), K153 (= K150), R157 (≠ L154), E186 (= E182), S187 (≠ G183), A188 (≠ T184), A189 (≠ S185), S190 (≠ N186), G210 (= G208), I211 (= I209), T212 (= T210), T248 (≠ A246)
6snlD (R)-selective amine transaminase from exophiala sideris (see paper)
30% identity, 95% coverage: 6:277/286 of query aligns to 30:304/320 of 6snlD
- active site: Y57 (= Y33), K178 (= K150), E211 (= E182), L233 (= L206)
- binding pyridoxal-5'-phosphate: R76 (= R52), K178 (= K150), E211 (= E182), G214 (≠ S185), F215 (≠ N186), L233 (= L206), G235 (= G208), V236 (≠ I209), T237 (= T210), T273 (≠ A246)
4ce5B First crystal structure of an (r)-selective omega-transaminase from aspergillus terreus (see paper)
28% identity, 98% coverage: 6:285/286 of query aligns to 33:314/325 of 4ce5B
- active site: Y60 (= Y33), K180 (= K150), E213 (= E182), L235 (= L206)
- binding calcium ion: D67 (≠ G40), R69 (≠ K42)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-d-glutamic acid: V62 (= V35), R79 (= R52), K180 (= K150), W184 (≠ L154), E213 (= E182), G216 (≠ S185), F217 (≠ N186), N218 (= N187), L235 (= L206), G237 (= G208), V238 (≠ I209), T239 (= T210), T274 (≠ S245), T275 (≠ A246), A276 (≠ S247)
- binding pyridoxal-5'-phosphate: R79 (= R52), K180 (= K150), E213 (= E182), G216 (≠ S185), F217 (≠ N186), L235 (= L206), G237 (= G208), V238 (≠ I209), T239 (= T210), T275 (≠ A246)
4ce5A First crystal structure of an (r)-selective omega-transaminase from aspergillus terreus (see paper)
28% identity, 98% coverage: 6:285/286 of query aligns to 33:314/325 of 4ce5A
- active site: Y60 (= Y33), K180 (= K150), E213 (= E182), L235 (= L206)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-d-glutamic acid: Y60 (= Y33), V62 (= V35), R79 (= R52), K180 (= K150), W184 (≠ L154), E213 (= E182), G216 (≠ S185), F217 (≠ N186), N218 (= N187), L235 (= L206), G237 (= G208), V238 (≠ I209), T239 (= T210), T274 (≠ S245), T275 (≠ A246)
- binding pyridoxal-5'-phosphate: R79 (= R52), K180 (= K150), E213 (= E182), F217 (≠ N186), L235 (= L206), G237 (= G208), V238 (≠ I209), T239 (= T210), T275 (≠ A246)
6fteB Crystal structure of an (r)-selective amine transaminase from exophiala xenobiotica
28% identity, 95% coverage: 6:277/286 of query aligns to 31:305/321 of 6fteB
- active site: Y58 (= Y33), K179 (= K150), E212 (= E182), L234 (= L206)
- binding pyridoxal-5'-phosphate: R77 (= R52), K179 (= K150), E212 (= E182), F216 (≠ N186), N217 (= N187), L234 (= L206), G236 (= G208), V237 (≠ I209), T238 (= T210), T274 (≠ A246)
7z79B Crystal structure of aminotransferase-like protein from variovorax paradoxus
30% identity, 95% coverage: 5:277/286 of query aligns to 18:291/306 of 7z79B
- binding pyridoxal-5'-phosphate: W46 (≠ Y33), R65 (= R52), N166 (≠ L155), S202 (= S185), T203 (≠ N186), F222 (≠ L206), G224 (= G208), I225 (= I209), T226 (= T210), G261 (≠ S245), T262 (≠ A246)
8ivpB Crystal structure of mv in complex with llp and fru from mycobacterium vanbaalenii
32% identity, 94% coverage: 6:275/286 of query aligns to 32:304/322 of 8ivpB
6xu3B (R)-selective amine transaminase from shinella sp. (see paper)
29% identity, 96% coverage: 6:279/286 of query aligns to 30:305/321 of 6xu3B
- active site: Y57 (= Y33), K177 (= K150), E210 (= E182), L232 (= L206)
- binding 3-aminobenzoic acid: P169 (vs. gap), D173 (= D148), K229 (≠ N203)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: R76 (= R52), Y112 (≠ L88), K177 (= K150), F184 (≠ P157), E210 (= E182), G213 (≠ S185), F214 (≠ N186), N215 (= N187), L232 (= L206), G234 (= G208), V235 (≠ I209), T236 (= T210), T272 (≠ A246)
6xu3C (R)-selective amine transaminase from shinella sp. (see paper)
29% identity, 96% coverage: 6:279/286 of query aligns to 31:306/322 of 6xu3C
- active site: Y58 (= Y33), K178 (= K150), E211 (= E182), L233 (= L206)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: V60 (= V35), R77 (= R52), K178 (= K150), F185 (≠ P157), E211 (= E182), G214 (≠ S185), N216 (= N187), L233 (= L206), G235 (= G208), V236 (≠ I209), T237 (= T210), T272 (≠ S245), T273 (≠ A246), A274 (≠ S247)
6xu3A (R)-selective amine transaminase from shinella sp. (see paper)
29% identity, 96% coverage: 6:279/286 of query aligns to 29:304/320 of 6xu3A
- active site: Y56 (= Y33), K176 (= K150), E209 (= E182), L231 (= L206)
- binding pyridoxal-5'-phosphate: R75 (= R52), K176 (= K150), F183 (≠ P157), E209 (= E182), G212 (≠ S185), F213 (≠ N186), L231 (= L206), G233 (= G208), V234 (≠ I209), T235 (= T210), T271 (≠ A246)
4cmfA The (r)-selective transaminase from nectria haematococca with inhibitor bound (see paper)
29% identity, 95% coverage: 6:277/286 of query aligns to 31:305/322 of 4cmfA
- active site: Y58 (= Y33), V60 (= V35), K179 (= K150), E212 (= E182), L234 (= L206)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: V60 (= V35), R77 (= R52), F113 (≠ L88), K179 (= K150), E212 (= E182), G215 (≠ S185), F216 (≠ N186), N217 (= N187), L234 (= L206), G236 (= G208), I237 (= I209), T238 (= T210), T273 (≠ S245), T274 (≠ A246), A275 (≠ S247)
4cmdA The (r)-selective transaminase from nectria haematococca (see paper)
29% identity, 95% coverage: 6:277/286 of query aligns to 31:305/322 of 4cmdA
- active site: Y58 (= Y33), V60 (= V35), K179 (= K150), E212 (= E182), L234 (= L206)
- binding pyridoxal-5'-phosphate: R77 (= R52), K179 (= K150), E212 (= E182), G215 (≠ S185), F216 (≠ N186), L234 (= L206), G236 (= G208), I237 (= I209), T238 (= T210), T274 (≠ A246)
Query Sequence
>GFF2997 FitnessBrowser__Phaeo:GFF2997
MTRTVYVNGDYLPEGDAKISIFDRGFLMADGVYEVTSVLGGKLIDFEGHAVRLKRSLDEL
EMAEPCSKEELLEIHRKLVALNEIEEGLVYLQVTRGSDGDRDFVFPSADTKPTIVLFTQN
KPGLADSPAAKKGAKIISIEDIRWGRRDIKTVQLLYPSMGKMMAKKAGADDAWMIEDGHV
TEGTSNNAYFVKNGVIVTRPLSNDILHGITRKAVLRMAEEAQMKIEERLFTIEEAKEADE
AFTTSASAFVMPVVEIDGVALGDGTPGPIAKRLREIYLEESMNAAI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory