Comparing GFF3010 FitnessBrowser__WCS417:GFF3010 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4jbbA Crystal structure of glutathione s-transferase a6tby7(target efi- 507184) from klebsiella pneumoniae mgh 78578, gsh complex
53% identity, 97% coverage: 1:198/205 of query aligns to 4:204/208 of 4jbbA
P77544 Glutathione S-transferase YfcF; EC 2.5.1.18 from Escherichia coli (strain K12) (see paper)
53% identity, 97% coverage: 1:198/205 of query aligns to 6:206/214 of P77544
3bbyA Crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution
51% identity, 97% coverage: 1:198/205 of query aligns to 4:186/191 of 3bbyA
4isdA Crystal structure of glutathione transferase homolog from burkholderia gl bgr1, target efi-501803, with bound glutathione
48% identity, 99% coverage: 3:204/205 of query aligns to 7:187/187 of 4isdA
4hojA Crystal structure of glutathione transferase homolog from neisseria gonorrhoeae, target efi-501841, with bound glutathione
30% identity, 95% coverage: 10:204/205 of query aligns to 8:191/197 of 4hojA
4qq7A Crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione
30% identity, 90% coverage: 10:193/205 of query aligns to 10:190/204 of 4qq7A
3qawA Crystal structure of a glutathione-s-transferase from antarctic clam laternula elliptica in a complex with glutathione (see paper)
33% identity, 42% coverage: 11:96/205 of query aligns to 11:96/219 of 3qawA
Q64471 Glutathione S-transferase theta-1; GST class-theta-1; EC 2.5.1.18 from Mus musculus (Mouse) (see paper)
29% identity, 79% coverage: 1:161/205 of query aligns to 3:168/240 of Q64471
Sites not aligning to the query:
4ecjA Crystal structure of glutathione s-transferase prk13972 (target efi- 501853) from pseudomonas aeruginosa pacs2 complexed with glutathione
30% identity, 75% coverage: 8:161/205 of query aligns to 5:160/204 of 4ecjA
4kdxA Crystal structure of a glutathione transferase family member from burkholderia graminis, target efi-507264, bound gsh, ordered domains, space group p21, form(1)
31% identity, 83% coverage: 10:179/205 of query aligns to 9:184/207 of 4kdxA
P30711 Glutathione S-transferase theta-1; GST class-theta-1; Glutathione transferase T1-1; EC 2.5.1.18 from Homo sapiens (Human) (see 2 papers)
30% identity, 79% coverage: 1:161/205 of query aligns to 3:168/240 of P30711
Sites not aligning to the query:
6tahB Glutathione S-transferase
29% identity, 75% coverage: 8:161/205 of query aligns to 6:161/213 of 6tahB
Sites not aligning to the query:
2c3qA Human glutathione-s-transferase t1-1 w234r mutant, complex with s- hexylglutathione (see paper)
30% identity, 79% coverage: 1:161/205 of query aligns to 2:167/239 of 2c3qA
Sites not aligning to the query:
4pxoA Crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068)
35% identity, 57% coverage: 9:124/205 of query aligns to 9:125/216 of 4pxoA
4xt0A Crystal structure of beta-etherase ligf from sphingobium sp. Strain syk-6 (see paper)
36% identity, 43% coverage: 14:101/205 of query aligns to 14:103/243 of 4xt0A
Sites not aligning to the query:
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
32% identity, 50% coverage: 9:110/205 of query aligns to 8:111/208 of 1fw1A
Sites not aligning to the query:
4mpgB Crystal structure of human glutathione transferase theta-2, complex with glutathione and unknown ligand, target efi-507257
33% identity, 49% coverage: 1:100/205 of query aligns to 11:109/252 of 4mpgB
Sites not aligning to the query:
3ljrA Glutathione transferase (theta class) from human in complex with the glutathione conjugate of 1-menaphthyl sulfate (see paper)
33% identity, 49% coverage: 1:100/205 of query aligns to 3:101/244 of 3ljrA
Sites not aligning to the query:
P0CG30 Glutathione S-transferase theta-2B; Glutathione S-transferase theta-2; GST class-theta-2; EC 2.5.1.18 from Homo sapiens (Human) (see 2 papers)
33% identity, 49% coverage: 1:100/205 of query aligns to 3:101/244 of P0CG30
Sites not aligning to the query:
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
32% identity, 49% coverage: 9:109/205 of query aligns to 12:114/216 of O43708
Sites not aligning to the query:
>GFF3010 FitnessBrowser__WCS417:GFF3010
MRLYVDHMYTSPYALSVFVTLREKGLAFDTITLDLDAAQQHAADFARLSLTQRVPTLVEG
DFALSESSAITEYLEQAYPGTPVYPADPKLRARARQVQAWLRSDLLPIRQERSTMVVFYG
QKMPPLSPVAEAAAAKLISAAQDLLVGNPAYLFGDWSIADVDLAVMLNRLILNGDSVPAE
LVEYAQRQWQRPSVQAWVNQHRPAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory