Comparing GFF3011 FitnessBrowser__psRCH2:GFF3011 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
48% identity, 99% coverage: 1:260/262 of query aligns to 1:259/261 of 2xuaH
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
32% identity, 96% coverage: 9:260/262 of query aligns to 9:260/265 of 6eb3A
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 96% coverage: 9:260/262 of query aligns to 9:263/268 of 6eb3B
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 96% coverage: 9:260/262 of query aligns to 9:257/262 of 6eb3C
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
29% identity, 94% coverage: 16:261/262 of query aligns to 21:268/272 of 4uheA
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
29% identity, 94% coverage: 16:261/262 of query aligns to 21:268/274 of 4uhdA
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
29% identity, 94% coverage: 16:261/262 of query aligns to 21:268/278 of 4uhfA
5h3hB Esterase (eaest) from exiguobacterium antarcticum (see paper)
26% identity, 82% coverage: 46:261/262 of query aligns to 47:267/269 of 5h3hB
Sites not aligning to the query:
6ap8A Crystal structure of rice d14 bound to 2-(2-methyl-3-nitroanilino) benzoic acid (see paper)
25% identity, 93% coverage: 11:254/262 of query aligns to 8:257/266 of 6ap8A
5dj5A Crystal structure of rice dwarf14 in complex with synthetic strigolactone gr24 (see paper)
25% identity, 93% coverage: 11:254/262 of query aligns to 8:257/266 of 5dj5A
5cbkA Crystal structure of the strigolactone receptor shhtl5 from striga hermonthica (see paper)
22% identity, 87% coverage: 24:250/262 of query aligns to 20:254/271 of 5cbkA
Sites not aligning to the query:
4ihaA Crystal structure of rice dwarf14 (d14) in complex with a gr24 hydrolysis intermediate (see paper)
25% identity, 93% coverage: 11:254/262 of query aligns to 10:259/268 of 4ihaA
5zhsA Crystal structure of osd14 in complex with covalently bound kk052 (see paper)
25% identity, 93% coverage: 11:254/262 of query aligns to 6:255/264 of 5zhsA
Q10QA5 Strigolactone esterase D14; Protein DWARF 14; Protein DWARF 88; Protein HIGH-TILLERING DWARF 2; EC 3.1.-.- from Oryza sativa subsp. japonica (Rice) (see 4 papers)
25% identity, 93% coverage: 11:254/262 of query aligns to 60:309/318 of Q10QA5
5zhtA Crystal structure of osd14 in complex with covalently bound kk073 (see paper)
25% identity, 93% coverage: 11:254/262 of query aligns to 7:256/265 of 5zhtA
5zhrA Crystal structure of osd14 in complex with covalently bound kk094 (see paper)
25% identity, 93% coverage: 11:254/262 of query aligns to 7:256/265 of 5zhrA
5yz7A Crystal structure of osd14 in complex with d-ring-opened 7'-carba-4bd (see paper)
25% identity, 93% coverage: 11:254/262 of query aligns to 7:256/265 of 5yz7A
6brtA F-box protein cth with hydrolase (see paper)
25% identity, 93% coverage: 11:254/262 of query aligns to 27:276/285 of 6brtA
Q9SQR3 Strigolactone esterase D14; Protein DWARF 14; AtD14; EC 3.1.-.- from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
23% identity, 85% coverage: 10:232/262 of query aligns to 9:235/267 of Q9SQR3
6o5jA Crystal structure of dad2 bound to quinazolinone derivative (see paper)
24% identity, 94% coverage: 10:256/262 of query aligns to 6:258/264 of 6o5jA
>GFF3011 FitnessBrowser__psRCH2:GFF3011
MPSVKLADVSLNYRFDGAENAPVLVLSNSLGTDLQMWDDQIAAFAEHFRVLRYDTRGHGG
SGVTPGPYSIEQLGQDVLGMLDAFGIERFAFCGLSMGGLIGQWLGIHAGERLQRLVLCNT
GAKIGTDEVWNTRIDSVLAGREQTMRDMRDASIARWFTADFAQANPAVAARITDMIASTS
PDGYAANCAAVRDADYREQLATIKTPTLIVCGAKDPVTTVEHGEFIQANIPGAELVAFEA
AHLSNVEAGDAFTQRVLTFLRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory