Comparing GFF3027 FitnessBrowser__WCS417:GFF3027 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
59% identity, 96% coverage: 1:240/250 of query aligns to 3:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
59% identity, 96% coverage: 1:240/250 of query aligns to 3:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
59% identity, 96% coverage: 1:240/250 of query aligns to 3:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
59% identity, 96% coverage: 1:240/250 of query aligns to 3:242/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
60% identity, 96% coverage: 1:241/250 of query aligns to 2:241/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
57% identity, 96% coverage: 1:240/250 of query aligns to 1:240/240 of 4ymuJ
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
56% identity, 94% coverage: 2:237/250 of query aligns to 7:254/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
56% identity, 94% coverage: 2:237/250 of query aligns to 3:250/258 of 1b0uA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 96% coverage: 1:241/250 of query aligns to 1:246/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 96% coverage: 1:241/250 of query aligns to 2:247/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 96% coverage: 1:241/250 of query aligns to 2:247/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 96% coverage: 1:241/250 of query aligns to 2:247/344 of 3tuiC
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
39% identity, 92% coverage: 1:230/250 of query aligns to 3:236/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
39% identity, 92% coverage: 1:230/250 of query aligns to 3:236/592 of 5lj7A
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
36% identity, 93% coverage: 5:236/250 of query aligns to 30:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
36% identity, 93% coverage: 5:236/250 of query aligns to 30:263/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
37% identity, 90% coverage: 5:229/250 of query aligns to 30:256/260 of 7ahdC
Sites not aligning to the query:
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
33% identity, 94% coverage: 2:236/250 of query aligns to 11:252/257 of P0AAH0
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 92% coverage: 1:229/250 of query aligns to 17:241/378 of P69874
Sites not aligning to the query:
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
40% identity, 85% coverage: 3:215/250 of query aligns to 8:217/223 of 2pclA
>GFF3027 FitnessBrowser__WCS417:GFF3027
MINIHQLHKHYGSHRVLHGVDLNVAKGEVVCLIGPSGSGKSTLLRCINALEAYDGGVITV
FGETVQRGSKTVHALRSRMGMVFQRFNLFPHRTVLENVMEGPVYVKGEPPTQAREEALVL
LEKVGLSAKADAYPEQLSGGQQQRVAIARALAMKPDAMLFDEPTSALDPELVGDVLAVMR
TLADEGMTMIVVTHEMGFAREVADRVCFLHGGYIVESGAAEQVLGNPQHPRTQDFLRRVL
HPTGDTRSLS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory