Comparing GFF3079 FitnessBrowser__Marino:GFF3079 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
5odqI Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. (see paper)
30% identity, 22% coverage: 15:101/402 of query aligns to 24:103/183 of 5odqI
Sites not aligning to the query:
5odhI Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with heterodisulfide for 3.5 minutes (see paper)
30% identity, 22% coverage: 15:101/402 of query aligns to 24:103/183 of 5odhI
Sites not aligning to the query:
5odcC Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus at 2.3 a resolution (see paper)
30% identity, 22% coverage: 15:101/402 of query aligns to 24:103/184 of 5odcC
5odcI Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus at 2.3 a resolution (see paper)
30% identity, 22% coverage: 15:101/402 of query aligns to 24:103/173 of 5odcI
>GFF3079 FitnessBrowser__Marino:GFF3079
MQTNLVQQFANTKEGQEAESILRACVHCGFCTATCPTYQELNDERDGPRGRIYLMKMFLE
GAEVTEKTREHLDRCLTCRSCETTCPSGVQYGRLVDISRGLMEKEMPREPKDKWLRWALA
RVIPNRQLFGVLLRLGQVFRPVLPEKLRTKVPPRKQASPWPAASHSRIVLALAGCVQPSA
TPNTNAAAARVLDRLGITMVEAPEAGCCGAVNYHLSEHEKGLERMRQNIDAWWPAIEAGA
EAIIMTASGCGAMVQDYGHLLKDDPVYAAKAQKVSELCTDLGAFLLKQDLEKLKVRQDPG
KVAFHCPCTLQHAMKQNGVVEQVLTRAGVNLAATKDKHLCCGSAGTYSVTQPEMSQKLLG
NKLKALTVDNPDRIVTANIGCQMHLETKSPVPVQHWIELLDQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory