Comparing GFF3087 HP15_3030 histidine/lysine/arginine/ornithine transporter subunit to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
63% identity, 98% coverage: 1:252/256 of query aligns to 1:253/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
65% identity, 95% coverage: 11:252/256 of query aligns to 7:249/258 of 1b0uA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
55% identity, 96% coverage: 7:253/256 of query aligns to 2:237/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
54% identity, 96% coverage: 12:256/256 of query aligns to 9:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
54% identity, 96% coverage: 12:256/256 of query aligns to 9:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
54% identity, 96% coverage: 12:256/256 of query aligns to 9:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
54% identity, 96% coverage: 12:256/256 of query aligns to 9:242/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
52% identity, 96% coverage: 6:252/256 of query aligns to 1:236/241 of 4u00A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 95% coverage: 11:252/256 of query aligns to 6:241/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 95% coverage: 11:252/256 of query aligns to 7:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 95% coverage: 11:252/256 of query aligns to 7:242/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 95% coverage: 11:252/256 of query aligns to 7:242/344 of 6cvlD
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
41% identity, 82% coverage: 7:215/256 of query aligns to 4:202/223 of 2pclA
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
39% identity, 89% coverage: 26:252/256 of query aligns to 46:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
39% identity, 89% coverage: 26:252/256 of query aligns to 46:263/382 of 7aheC
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
40% identity, 85% coverage: 13:230/256 of query aligns to 13:220/226 of 5xu1B
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
39% identity, 81% coverage: 5:211/256 of query aligns to 2:203/648 of P75831
7ahdC Opua (e190q) occluded (see paper)
39% identity, 88% coverage: 26:249/256 of query aligns to 46:260/260 of 7ahdC
Sites not aligning to the query:
1g291 Malk (see paper)
34% identity, 95% coverage: 11:252/256 of query aligns to 8:240/372 of 1g291
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
35% identity, 91% coverage: 11:243/256 of query aligns to 11:234/375 of 2d62A
>GFF3087 HP15_3030 histidine/lysine/arginine/ornithine transporter subunit
MADQSPLICRDIYKTFDQLEVLKGISLETRKGDVVSLIGSSGSGKSTFLRCINLLETPTS
GDIIVHGDPIRFTTNRKGERIPADNKQVELIRAKLSMVFQSFNLWSHMTVLENIIEAPVH
VLKVPKKEAIERAEAYLNKVGIYERKDYYPAQMSGGQQQRAAIARALAMEPEVMLFDEPT
SALDPELVGEVLKVMQGLAEEGRTMIVVTHEMAFARDVSSQVLFLHQGVIEEQGTPEKVF
DHPDSERMKQFLTPNF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory