Comparing GFF3088 FitnessBrowser__Marino:GFF3088 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5orgA Structure of the periplasmic binding protein (pbp) occj from a. Tumefaciens b6 in complex with octopine. (see paper)
35% identity, 91% coverage: 22:248/250 of query aligns to 2:254/257 of 5orgA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
34% identity, 99% coverage: 1:248/250 of query aligns to 1:257/260 of P02911
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
36% identity, 88% coverage: 26:245/250 of query aligns to 6:224/225 of 4zv2A
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
35% identity, 90% coverage: 24:248/250 of query aligns to 26:257/260 of P02910
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
35% identity, 90% coverage: 24:248/250 of query aligns to 4:235/238 of 1hslA
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
34% identity, 90% coverage: 24:248/250 of query aligns to 26:257/260 of P0AEU0
Sites not aligning to the query:
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
34% identity, 89% coverage: 26:248/250 of query aligns to 3:232/235 of 5owfA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
35% identity, 88% coverage: 26:245/250 of query aligns to 6:226/226 of 4zv1A
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
34% identity, 89% coverage: 26:248/250 of query aligns to 6:235/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
34% identity, 89% coverage: 26:248/250 of query aligns to 6:235/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
34% identity, 89% coverage: 26:248/250 of query aligns to 6:235/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
34% identity, 89% coverage: 26:248/250 of query aligns to 6:235/238 of 1lafE
8hqrA Crystal structure of the arginine-/lysine-binding protein sar11_1210 from 'candidatus pelagibacter ubique' htcc1062 bound to arginine
36% identity, 90% coverage: 26:250/250 of query aligns to 10:267/267 of 8hqrA
3tqlA Structure of the amino acid abc transporter, periplasmic amino acid- binding protein from coxiella burnetii. (see paper)
35% identity, 88% coverage: 26:244/250 of query aligns to 4:225/225 of 3tqlA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
34% identity, 88% coverage: 26:245/250 of query aligns to 12:228/229 of 6svfA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
36% identity, 88% coverage: 26:244/250 of query aligns to 12:228/229 of 5t0wA
5itoA Structure of the periplasmic binding protein m117n-noct from a. Tumefaciens in complex with octopine (see paper)
31% identity, 90% coverage: 24:247/250 of query aligns to 3:252/255 of 5itoA
5otcA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with noroctopinic acid. (see paper)
31% identity, 90% coverage: 24:247/250 of query aligns to 2:251/256 of 5otcA
5ovzA High resolution structure of the pbp noct in complex with nopaline (see paper)
31% identity, 90% coverage: 24:247/250 of query aligns to 3:252/259 of 5ovzA
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
31% identity, 90% coverage: 24:247/250 of query aligns to 2:251/254 of 5otaA
>GFF3088 FitnessBrowser__Marino:GFF3088
MKKMIFAASCALALIAGGAQAQERDLRIAFDVPYEPFEYKDENGELTGFEVELAEAMCEE
MNANCEFVIQAWDGMIPGLLARKFDLIMSSMSITPERAERVLFSEPYYNTPGGWFGPESF
NTDVTDMSAMEGKTVGVQRGTTMDTYVTENMGGIVTIKRYTTADDMVLDLEGQRLDVVFV
DYPVGEQTVLTKEGFKEVGEAVKLGEGVGVAMRQRDTDLAEEVNAALRTLKEDGTYDTIM
QKYFAYDIKM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory