SitesBLAST
Comparing GFF3098 FitnessBrowser__WCS417:GFF3098 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7f3pD Crystal structure of a NADP-dependent alcohol dehydrogenase mutant in apo form (see paper)
37% identity, 98% coverage: 4:352/357 of query aligns to 4:349/355 of 7f3pD
1ykfA NADP-dependent alcohol dehydrogenase from thermoanaerobium brockii (see paper)
37% identity, 98% coverage: 4:352/357 of query aligns to 1:346/352 of 1ykfA
- active site: C37 (= C40), T38 (≠ G41), S39 (≠ T42), H42 (= H45), H59 (= H61), E60 (= E62), D89 (≠ S91), T92 (≠ S94), V95 (≠ C97), S103 (≠ D105), D150 (= D159), T154 (= T163), K346 (= K352)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S39 (≠ T42), D150 (= D159), T154 (= T163), G174 (≠ A183), I175 (≠ L184), G176 (= G185), P177 (= P186), V178 (≠ I187), S199 (≠ A208), R200 (≠ V209), Y218 (≠ F227), I223 (≠ V232), N266 (≠ G275), Y267 (≠ V276)
- binding zinc ion: C37 (= C40), H59 (= H61), D150 (= D159)
1bxzB Crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii (see paper)
37% identity, 98% coverage: 4:352/357 of query aligns to 1:346/352 of 1bxzB
- active site: C37 (= C40), T38 (≠ G41), S39 (≠ T42), H42 (= H45), H59 (= H61), E60 (= E62), D89 (≠ S91), T92 (≠ S94), V95 (≠ C97), S103 (≠ D105), D150 (= D159), T154 (= T163), K346 (= K352)
- binding 2-butanol: H59 (= H61), D150 (= D159)
P14941 NADP-dependent isopropanol dehydrogenase; EC 1.1.1.80 from Thermoanaerobacter brockii (Thermoanaerobium brockii) (see 2 papers)
37% identity, 98% coverage: 4:352/357 of query aligns to 1:346/352 of P14941
7uutA Ternary complex crystal structure of secondary alcohol dehydrogenases from the thermoanaerobacter ethanolicus mutants c295a and i86a provides better understanding of catalytic mechanism (see paper)
37% identity, 98% coverage: 4:352/357 of query aligns to 1:346/352 of 7uutA
- binding (2R)-pentan-2-ol: S39 (≠ T42), H59 (= H61), A85 (= A87), W110 (= W119), D150 (= D159), C295 (= C302)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C37 (= C40), T38 (≠ G41), S39 (≠ T42), D150 (= D159), T154 (= T163), G174 (≠ A183), G176 (= G185), P177 (= P186), V178 (≠ I187), S199 (≠ A208), R200 (≠ V209), A242 (= A251), G243 (≠ L252), G244 (= G253), I248 (≠ T257), V265 (≠ L274), N266 (≠ G275), Y267 (≠ V276), C295 (= C302), K340 (≠ Q346)
- binding zinc ion: C37 (= C40), H59 (= H61), D150 (= D159)
7ux4A Crystallographic snapshots of ternary complexes of thermophilic secondary alcohol dehydrogenase from thermoanaerobacter pseudoethanolicus reveal the dynamics of ligand exchange and the proton relay network. (see paper)
38% identity, 94% coverage: 18:352/357 of query aligns to 15:344/350 of 7ux4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D148 (= D159), T152 (= T163), G172 (≠ A183), I173 (≠ L184), G174 (= G185), P175 (= P186), V176 (≠ I187), R198 (≠ V209), G242 (= G253), V263 (≠ L274), N264 (≠ G275), Y265 (≠ V276), C293 (= C302)
- binding (1S,3S)-3-methylcyclohexan-1-ol: S37 (≠ T42), H57 (= H61), W108 (= W119), D148 (= D159)
- binding zinc ion: C35 (= C40), H57 (= H61), E58 (= E62), D148 (= D159)
3fpcA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-294 of t. Brockii adh by e. Histolytica adh (see paper)
37% identity, 98% coverage: 4:352/357 of query aligns to 1:346/352 of 3fpcA
- active site: C37 (= C40), T38 (≠ G41), S39 (≠ T42), H42 (= H45), H59 (= H61), E60 (= E62), D89 (≠ S91), T92 (≠ S94), V95 (≠ C97), S103 (≠ D105), D150 (= D159), T154 (= T163), K346 (= K352)
- binding zinc ion: C37 (= C40), H59 (= H61), D150 (= D159)
3fsrA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-295 of t. Brockii adh by c. Beijerinckii adh (see paper)
37% identity, 98% coverage: 4:352/357 of query aligns to 1:346/352 of 3fsrA
- active site: C37 (= C40), T38 (≠ G41), S39 (≠ T42), H42 (= H45), H59 (= H61), E60 (= E62), D89 (≠ S91), T92 (≠ S94), V95 (≠ C97), S103 (≠ D105), D150 (= D159), T154 (= T163), K346 (= K352)
- binding zinc ion: C37 (= C40), H59 (= H61), D150 (= D159)
7xy9A Cryo-em structure of secondary alcohol dehydrogenases tbsadh after carrier-free immobilization based on weak intermolecular interactions
38% identity, 94% coverage: 18:352/357 of query aligns to 18:339/344 of 7xy9A
- binding magnesium ion: H101 (≠ A102), H103 (≠ Q104), H158 (≠ S166), C288 (= C302), G290 (= G304), G291 (= G305), L293 (≠ E307), R294 (= R308)
- binding zinc ion: C38 (= C40), H60 (= H61), E61 (= E62), D151 (= D159)
P35630 NADP-dependent isopropanol dehydrogenase; EhADH1; EC 1.1.1.80 from Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM) (see paper)
37% identity, 96% coverage: 3:346/357 of query aligns to 6:346/366 of P35630
- C43 (= C40) binding
- H65 (= H61) binding
- E66 (= E62) binding
- D156 (= D159) binding
3fplA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-295 of c. Beijerinckii adh by t. Brockii adh (see paper)
36% identity, 99% coverage: 4:355/357 of query aligns to 1:349/351 of 3fplA
- active site: C37 (= C40), T38 (≠ G41), S39 (≠ T42), H42 (= H45), H59 (= H61), E60 (= E62), D89 (≠ S91), S92 (= S94), V95 (≠ C97), S103 (≠ G112), D150 (= D159), T154 (= T163), K346 (= K352)
- binding zinc ion: C37 (= C40), H59 (= H61), D150 (= D159)
1y9aA Alcohol dehydrogenase from entamoeba histolotica in complex with cacodylate (see paper)
37% identity, 98% coverage: 4:352/357 of query aligns to 1:346/360 of 1y9aA
- active site: C37 (= C40), T38 (≠ G41), S39 (≠ T42), H42 (= H45), H59 (= H61), E60 (= E62), D89 (≠ S91), E92 (≠ S94), S95 (≠ C97), S103 (≠ D105), D150 (= D159), T154 (= T163), K346 (= K352)
- binding acetate ion: P24 (= P27), G69 (= G71), S70 (= S72)
- binding cacodylate ion: S39 (≠ T42), H59 (= H61), W110 (= W119), D150 (= D159)
- binding 1,2-ethanediol: G98 (= G100), Y99 (≠ C101), M101 (≠ S103), H157 (≠ S166)
- binding zinc ion: C37 (= C40), D51 (≠ V53), H53 (≠ K55), H59 (= H61), D150 (= D159)
2ouiA D275p mutant of alcohol dehydrogenase from protozoa entamoeba histolytica (see paper)
37% identity, 98% coverage: 4:352/357 of query aligns to 1:346/360 of 2ouiA
- active site: C37 (= C40), T38 (≠ G41), S39 (≠ T42), H42 (= H45), H59 (= H61), E60 (= E62), D89 (≠ S91), E92 (≠ S94), S95 (≠ C97), S103 (≠ D105), D150 (= D159), T154 (= T163), K346 (= K352)
- binding zinc ion: C37 (= C40), H59 (= H61), D150 (= D159)
1kevA Structure of NADP-dependent alcohol dehydrogenase (see paper)
35% identity, 99% coverage: 4:355/357 of query aligns to 1:349/351 of 1kevA
- active site: C37 (= C40), T38 (≠ G41), S39 (≠ T42), H42 (= H45), H59 (= H61), E60 (= E62), D89 (≠ S91), S92 (= S94), V95 (≠ C97), S103 (≠ G112), D150 (= D159), T154 (= T163), K346 (= K352)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T38 (≠ G41), D150 (= D159), I175 (≠ L184), G176 (= G185), V178 (≠ I187), S199 (≠ A208), R200 (≠ V209), Y218 (≠ F227), A242 (= A251), G244 (= G253), N266 (≠ G275), Y267 (≠ V276), K340 (≠ Q346)
- binding zinc ion: C37 (= C40), H59 (= H61), D150 (= D159)
P25984 NADP-dependent isopropanol dehydrogenase; CbADH; EC 1.1.1.80 from Clostridium beijerinckii (Clostridium MP) (see 3 papers)
35% identity, 99% coverage: 4:355/357 of query aligns to 1:349/351 of P25984
6schC Nadh-dependent variant of cbadh (see paper)
36% identity, 99% coverage: 4:355/357 of query aligns to 1:349/355 of 6schC
- active site: C37 (= C40), S39 (≠ T42), H42 (= H45), H59 (= H61), D150 (= D159)
- binding nicotinamide-adenine-dinucleotide: T38 (≠ G41), W110 (= W119), D150 (= D159), T154 (= T163), G174 (≠ A183), V178 (≠ I187), D198 (= D207), Y199 (≠ A208), R200 (≠ V209), A242 (= A251), G243 (≠ L252), G244 (= G253), N266 (≠ G275), Y267 (≠ V276), K340 (≠ Q346)
- binding zinc ion: C37 (= C40), H59 (= H61), D150 (= D159)
5ylnA Zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form
35% identity, 99% coverage: 1:355/357 of query aligns to 2:341/348 of 5ylnA
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
31% identity, 99% coverage: 4:356/357 of query aligns to 1:344/346 of 4cpdA
- active site: C38 (= C40), G39 (= G41), S40 (≠ T42), H43 (= H45), H59 (= H61), E60 (= E62), C89 (= C99), C92 (vs. gap), C95 (= C101), C103 (≠ T109), G107 (≠ F113), D152 (= D159), T156 (= T163), K340 (= K352)
- binding nicotinamide-adenine-dinucleotide: G39 (= G41), S40 (≠ T42), T156 (= T163), G178 (= G185), P179 (= P186), V180 (≠ I187), D200 (= D207), R201 (≠ A208), R205 (= R212), A243 (= A251), V244 (≠ L252), V266 (≠ L274), V268 (= V276), L292 (= L292), A293 (≠ G293), F333 (= F343)
- binding zinc ion: C38 (= C40), H59 (= H61), C89 (= C99), C92 (vs. gap), C95 (= C101), C103 (≠ T109), D152 (= D159)
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
32% identity, 94% coverage: 15:349/357 of query aligns to 13:334/341 of P07913
- C38 (= C40) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
30% identity, 92% coverage: 22:349/357 of query aligns to 22:339/346 of 2dfvA
- active site: C40 (= C40), G41 (= G41), T42 (= T42), H45 (= H45), H65 (= H61), E66 (= E62), C95 (≠ S91), C98 (≠ S94), C101 (= C97), C109 (≠ F113), K113 (≠ G117), P151 (≠ I160), A155 (≠ G164)
- binding nicotinamide-adenine-dinucleotide: G175 (= G185), P176 (= P186), L177 (≠ I187), E197 (≠ D207), P198 (≠ A208), R202 (= R212), F241 (≠ A251), S242 (≠ L252), A244 (≠ T254), L264 (= L274), G265 (= G275), L266 (≠ V276), I289 (= I297), T290 (≠ V298)
- binding zinc ion: C95 (≠ S91), C101 (= C97), C109 (≠ F113)
Sites not aligning to the query:
Query Sequence
>GFF3098 FitnessBrowser__WCS417:GFF3098
MATMKAAIFVEKNRIVLEDKPIPEVGPLDALIRITTTTICGTDVHILRGEYPVAKGLTIG
HEPVGIIERLGSQVRGFVEGQRVIAGAITPSGQSYACLCGCASQDGPDTRHGFRATGGWK
FGNIIDGCQAEYVLVPDALANLCPIPDGLSDEQVLMCPDIMSTGFSGAERGEINIGDTVA
VFALGPIGLCAVAGARLKGATTIIGVDAVAQRMSVARQLGATHVVNFKEANVVEQIMALT
DGRGVDVSIEALGTQGTFESALRVLRPGGRLSSLGVYSSDLRIPLDAFAAGLGDYSIVTT
LCPGGKERMRRLMAVVQSGAVDLSPLVTHHFKLDDIEAAYELFANQRDGVMKVAITP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory