Comparing GFF31 FitnessBrowser__Phaeo:GFF31 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
53% identity, 99% coverage: 4:323/324 of query aligns to 1:316/318 of Q9I6K2
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
53% identity, 98% coverage: 7:323/324 of query aligns to 1:313/315 of 3niqA
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
53% identity, 98% coverage: 6:323/324 of query aligns to 1:314/316 of 3nipB
Q9I3S3 Guanidinobutyrase; EC 3.5.3.7 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
47% identity, 99% coverage: 4:323/324 of query aligns to 1:319/319 of Q9I3S3
3nioA Crystal structure of pseudomonas aeruginosa guanidinobutyrase (see paper)
48% identity, 98% coverage: 7:323/324 of query aligns to 1:316/316 of 3nioA
1gq6B Proclavaminate amidino hydrolase from streptomyces clavuligerus (see paper)
40% identity, 94% coverage: 18:320/324 of query aligns to 2:300/301 of 1gq6B
P0DJQ3 Proclavaminate amidinohydrolase; Proclavaminic acid amidino hydrolase; EC 3.5.3.22 from Streptomyces clavuligerus (see paper)
40% identity, 94% coverage: 18:320/324 of query aligns to 10:308/313 of P0DJQ3
P60651 Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 from Escherichia coli (strain K12) (see paper)
39% identity, 91% coverage: 26:319/324 of query aligns to 19:302/306 of P60651
7lbaB E. Coli agmatinase (see paper)
39% identity, 91% coverage: 26:319/324 of query aligns to 26:309/310 of 7lbaB
7lolA The structure of agmatinase from e. Coli at 1.8 a displaying urea and agmatine (see paper)
39% identity, 91% coverage: 26:319/324 of query aligns to 9:292/294 of 7lolA
7loxA The structure of agmatinase from e. Coli at 3.2 a displaying guanidine in the active site (see paper)
39% identity, 91% coverage: 26:319/324 of query aligns to 5:282/284 of 7loxA
4dz4B X-ray crystal structure of a hypothetical agmatinase from burkholderia thailandensis (see paper)
37% identity, 92% coverage: 20:316/324 of query aligns to 28:314/323 of 4dz4B
7esrA Crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) (see paper)
28% identity, 95% coverage: 16:323/324 of query aligns to 50:362/378 of 7esrA
1wogA Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily (see paper)
32% identity, 91% coverage: 20:315/324 of query aligns to 7:296/303 of 1wogA
Q57757 Agmatinase; EC 3.5.3.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
29% identity, 89% coverage: 26:314/324 of query aligns to 5:280/284 of Q57757
3lhlA Crystal structure of a putative agmatinase from clostridium difficile
27% identity, 87% coverage: 40:322/324 of query aligns to 3:276/276 of 3lhlA
6vsuE Arginase from arabidopsis thaliana in complex with ornithine (see paper)
32% identity, 83% coverage: 46:313/324 of query aligns to 43:312/318 of 6vsuE
P46637 Arginase 1, mitochondrial; Agmatinase ARGAH1; Arginine amidohydrolase 1; AtARGAH1; EC 3.5.3.1; EC 3.5.3.11 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
32% identity, 83% coverage: 46:313/324 of query aligns to 67:336/342 of P46637
Sites not aligning to the query:
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
30% identity, 84% coverage: 40:310/324 of query aligns to 21:278/293 of 3pzlB
3m1rD The crystal structure of formimidoylglutamase from bacillus subtilis subsp. Subtilis str. 168
26% identity, 83% coverage: 45:314/324 of query aligns to 41:313/321 of 3m1rD
>GFF31 FitnessBrowser__Phaeo:GFF31
MASLPTDFFHPVSGMEMPRFAGLPTFMRLPHVTVSDPIIDQVQLGLVGVPWDAGTTNRPG
PRHGPRQLRDLSTMIRAGNPVTGINPFSMINCADLGDVAPNPVDIIDCMERISAFYADLK
SRDIFALTVGGDHLVSLPVLRGLASGAPVGLIQFDSHTDLFDSYFGGNKYTHGTPFRRAI
EEGLVDPKRMVQIGIRGTAYNTEDVEWGQAQGVRIIRIEEFFDRGVSDVMREVREIVGDQ
PTYCTYDIDFVDPAFAPGTGTPEVGGPNSFQALQVVRELAGVQLVGADLVEVSPPFDTNG
NTAWLGASILFEMLCVSAGAISRR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory