Comparing GFF310 FitnessBrowser__WCS417:GFF310 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1h5yB Hisf protein from pyrobaculum aerophilum (see paper)
54% identity, 99% coverage: 3:256/256 of query aligns to 3:252/253 of 1h5yB
7ac8A Molecular basis for the unique allosteric activation mechanism of the heterodimeric imidazole glycerol phosphate synthase complex. (see paper)
52% identity, 99% coverage: 3:256/256 of query aligns to 2:249/252 of 7ac8A
Q9X0C6 Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
52% identity, 99% coverage: 3:256/256 of query aligns to 2:249/253 of Q9X0C6
1gpwC Structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex. (see paper)
52% identity, 99% coverage: 3:256/256 of query aligns to 2:249/253 of 1gpwC
7qc8A Imidazole glycerol phosphate synthase subunit HisF (see paper)
51% identity, 100% coverage: 2:256/256 of query aligns to 1:249/250 of 7qc8A
4ewnD Structure of hisf-d130v+d176v with bound rcdrp (see paper)
50% identity, 99% coverage: 3:256/256 of query aligns to 1:242/243 of 4ewnD
3zr4E Structural evidence for ammonia tunneling across the (beta-alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex (see paper)
50% identity, 99% coverage: 3:256/256 of query aligns to 2:240/244 of 3zr4E
5d2tA Directed evolutionary changes in kemp eliminase ke07 - crystal 3 wild type
47% identity, 99% coverage: 4:256/256 of query aligns to 1:247/251 of 5d2tA
6dnjA Directed evolutionary changes in kemp eliminase ke07 - crystal 28 round 5 (see paper)
47% identity, 99% coverage: 3:256/256 of query aligns to 1:248/250 of 6dnjA
2wjzE Crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity (see paper)
49% identity, 99% coverage: 3:256/256 of query aligns to 2:235/237 of 2wjzE
3iivB Evolutionary optimization of computationally designed enzymes: kemp eliminases of the ke07 series (see paper)
46% identity, 100% coverage: 2:256/256 of query aligns to 1:248/262 of 3iivB
P60664 Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 from Escherichia coli (strain K12) (see paper)
42% identity, 99% coverage: 3:256/256 of query aligns to 2:256/258 of P60664
P33734 Imidazole glycerol phosphate synthase hisHF; IGP synthase; IGPS; ImGP synthase; EC 4.3.2.10; EC 3.5.1.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
36% identity, 99% coverage: 3:256/256 of query aligns to 236:548/552 of P33734
1ox4B Towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase (see paper)
37% identity, 99% coverage: 3:256/256 of query aligns to 239:536/538 of 1ox4B
1ox5A Towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase (see paper)
37% identity, 99% coverage: 3:256/256 of query aligns to 239:530/532 of 1ox5A
3tdmA Computationally designed tim-barrel protein, halfflr (see paper)
44% identity, 39% coverage: 124:223/256 of query aligns to 1:95/120 of 3tdmA
Sites not aligning to the query:
5ab3A S.Enterica hisa mutant d7n, d10g, dup13-15, q24l, g102a (see paper)
28% identity, 93% coverage: 7:244/256 of query aligns to 2:235/241 of 5ab3A
5abtA S.Enterica hisa mutant d7n, g102a, v106m, d176a
27% identity, 93% coverage: 7:244/256 of query aligns to 2:238/246 of 5abtA
3zs4A Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase with bound prfar
26% identity, 94% coverage: 7:246/256 of query aligns to 5:240/244 of 3zs4A
2y85A Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase with bound rcdrp (see paper)
25% identity, 94% coverage: 7:246/256 of query aligns to 5:231/234 of 2y85A
>GFF310 FitnessBrowser__WCS417:GFF310
MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGR
DTTLHTVERMASQVFIPLTVGGGVRTVQDIRNLLNAGADKVSINTAAVFNPEFVGEAAQH
FGSQCIVVAIDAKKVSGPGETPRWEIFTHGGRKPTGLDAVEWAVKMEGLGAGEILLTSMD
QDGMKNGFDLGVTRAISDALGIPVIASGGVGNLQHLADGVTEGHASAVLAASIFHFGEYT
VPEAKAYMAARGIVVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory