SitesBLAST
Comparing GFF3114 FitnessBrowser__Phaeo:GFF3114 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9FLY0 Protein SAR DEFICIENT 4; Ornithine cyclodeaminase-like protein; AtOCD from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 79% coverage: 60:302/306 of query aligns to 68:321/325 of Q9FLY0
- G89 (= G81) mutation to E: In sard4-3; compromises systemic acquired resistance (SAR).
- G138 (= G130) mutation to D: In sard4-4; compromises systemic acquired resistance (SAR).
- S205 (≠ L188) mutation to N: In sard4-1; compromises systemic acquired resistance (SAR).
4bvaA Crystal structure of the NADPH-t3 form of mouse mu-crystallin. (see paper)
32% identity, 74% coverage: 80:305/306 of query aligns to 83:303/303 of 4bvaA
- active site: S219 (≠ Y215)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T106 (= T103), R109 (≠ K106), T110 (= T107), G135 (= G132), V136 (≠ T133), Q137 (≠ V134), N158 (= N155), R159 (= R156), T160 (= T157), N163 (≠ K160), V194 (≠ C190), T195 (= T191), M196 (= M192), A197 (≠ S193), V216 (≠ I212), S282 (≠ N284), L283 (≠ G285), G284 (= G286)
- binding 3,5,3'triiodothyronine: S219 (≠ Y215), R220 (= R216), W223 (≠ M219), E247 (≠ H243)
Sites not aligning to the query:
Q14894 Ketimine reductase mu-crystallin; NADP-regulated thyroid-hormone-binding protein; EC 1.5.1.25 from Homo sapiens (Human) (see paper)
32% identity, 75% coverage: 77:305/306 of query aligns to 90:313/314 of Q14894
4bv9A Crystal structure of the NADPH form of mouse mu-crystallin. (see paper)
32% identity, 74% coverage: 77:303/306 of query aligns to 81:302/303 of 4bv9A
- active site: S220 (≠ Y215)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S82 (≠ M78), H83 (≠ V79), T111 (= T107), G134 (= G130), G136 (= G132), V137 (≠ T133), Q138 (≠ V134), N159 (= N155), R160 (= R156), T161 (= T157), V195 (≠ C190), T196 (= T191), M197 (= M192), A198 (≠ S193), V217 (≠ I212), G218 (= G213), S283 (≠ N284), L284 (≠ G285), G285 (= G286)
- binding pyruvic acid: R110 (≠ K106)
Sites not aligning to the query:
2i99A Crystal structure of human mu_crystallin at 2.6 angstrom (see paper)
32% identity, 75% coverage: 77:305/306 of query aligns to 89:312/312 of 2i99A
- active site: S228 (≠ Y215)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S90 (≠ M78), H91 (≠ V79), R118 (≠ K106), T119 (= T107), G142 (= G130), A143 (= A131), G144 (= G132), V145 (≠ T133), Q146 (≠ V134), N167 (= N155), R168 (= R156), T169 (= T157), V203 (≠ C190), T204 (= T191), L205 (≠ M192), A206 (≠ S193), V225 (≠ I212), G226 (= G213), S291 (≠ N284), L292 (≠ G285), G293 (= G286)
Sites not aligning to the query:
6t3eB Structure of thermococcus litoralis delta(1)-pyrroline-2-carboxylate reductase in complex with nadh and l-proline (see paper)
29% identity, 79% coverage: 56:296/306 of query aligns to 60:308/325 of 6t3eB
- binding 1,4-dihydronicotinamide adenine dinucleotide: S82 (≠ M78), T111 (= T107), G136 (= G132), V137 (≠ T133), Q138 (≠ V134), D159 (≠ N155), I160 (≠ R156), A199 (≠ C190), T200 (= T191), T201 (≠ M192), A202 (≠ S193), V206 (= V197), V221 (≠ I212), G222 (= G213), W223 (≠ A214), S296 (≠ N284), V297 (≠ G285), G298 (= G286)
- binding proline: K67 (= K63), R110 (≠ K106)
Sites not aligning to the query:
1omoA Alanine dehydrogenase dimer w/bound NAD (archaeal) (see paper)
29% identity, 76% coverage: 69:300/306 of query aligns to 71:306/320 of 1omoA
- active site: D219 (≠ Y215)
- binding nicotinamide-adenine-dinucleotide: T109 (= T107), G134 (= G132), T135 (= T133), Q136 (≠ V134), Y156 (≠ W154), D157 (≠ N155), V158 (≠ R156), R159 (≠ T157), T195 (= T191), P196 (≠ M192), G217 (= G213), D219 (≠ Y215), K223 (≠ M219), S290 (≠ N284), T291 (≠ G285), G292 (= G286)
Sites not aligning to the query:
O28608 Alanine dehydrogenase; AlaDH; EC 1.4.1.1 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
29% identity, 76% coverage: 69:300/306 of query aligns to 71:306/322 of O28608
5yu4A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
27% identity, 58% coverage: 60:238/306 of query aligns to 74:259/344 of 5yu4A
- binding 2,4-diaminobutyric acid: K77 (= K63), R121 (≠ K106)
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ I67), T93 (≠ M78), I94 (≠ V79), R121 (≠ K106), T122 (= T107), G147 (= G132), A148 (≠ T133), Q149 (≠ V134), D170 (≠ N155), T171 (≠ R156), H175 (≠ K160), A208 (≠ C190), T209 (= T191), S210 (vs. gap), V211 (vs. gap), V218 (= V197), V233 (≠ I212), A235 (= A214)
Sites not aligning to the query:
5yu3A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
27% identity, 58% coverage: 60:238/306 of query aligns to 74:259/344 of 5yu3A
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ I67), T93 (≠ M78), I94 (≠ V79), T122 (= T107), G147 (= G132), A148 (≠ T133), Q149 (≠ V134), D170 (≠ N155), T171 (≠ R156), A208 (≠ C190), T209 (= T191), S210 (vs. gap), V211 (vs. gap), V233 (≠ I212), A235 (= A214)
- binding proline: K77 (= K63), R121 (≠ K106)
Sites not aligning to the query:
5gziA Cyclodeaminase_pa
27% identity, 58% coverage: 60:238/306 of query aligns to 78:263/354 of 5gziA
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ I67), T97 (≠ M78), R125 (≠ K106), T126 (= T107), G151 (= G132), A152 (≠ T133), Q153 (≠ V134), D174 (≠ N155), T175 (≠ R156), H179 (≠ K160), A212 (≠ C190), T213 (= T191), S214 (vs. gap), V215 (vs. gap), V237 (≠ I212), G238 (= G213), A239 (= A214)
- binding (2S)-piperidine-2-carboxylic acid: K81 (= K63), R125 (≠ K106), A239 (= A214)
Sites not aligning to the query:
5gzlA Cyclodeaminase_pa
27% identity, 58% coverage: 60:238/306 of query aligns to 78:263/357 of 5gzlA
- binding lysine: D240 (≠ Y215)
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ I67), T97 (≠ M78), I98 (≠ V79), T126 (= T107), G151 (= G132), A152 (≠ T133), Q153 (≠ V134), D174 (≠ N155), T175 (≠ R156), H179 (≠ K160), A212 (≠ C190), T213 (= T191), S214 (vs. gap), V222 (= V197), V237 (≠ I212), G238 (= G213), A239 (= A214), D240 (≠ Y215), K244 (≠ M219)
Sites not aligning to the query:
6rqaB Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
25% identity, 80% coverage: 58:303/306 of query aligns to 64:312/322 of 6rqaB
- binding Tb-Xo4: N76 (≠ G70)
- binding nicotinamide-adenine-dinucleotide: T113 (= T107), G138 (= G132), Q140 (≠ V134), P162 (≠ R156), H163 (≠ T157), I199 (≠ C190), T200 (= T191), S201 (≠ M192), S202 (= S193), M221 (≠ I212), G222 (= G213), D224 (≠ Y215), K228 (≠ M219), G293 (≠ N284), T294 (≠ G285), G295 (= G286)
Sites not aligning to the query:
6rqaA Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
25% identity, 80% coverage: 58:303/306 of query aligns to 64:312/322 of 6rqaA
- binding nicotinamide-adenine-dinucleotide: H85 (vs. gap), T113 (= T107), G138 (= G132), H139 (≠ T133), Q140 (≠ V134), N161 (= N155), P162 (≠ R156), H163 (≠ T157), M166 (≠ K160), I199 (≠ C190), T200 (= T191), S201 (≠ M192), S202 (= S193), M221 (≠ I212), G222 (= G213), D224 (≠ Y215), K228 (≠ M219), G293 (≠ N284)
A1B8Z0 Iminosuccinate reductase; EC 1.4.1.- from Paracoccus denitrificans (strain Pd 1222) (see paper)
25% identity, 80% coverage: 58:303/306 of query aligns to 62:310/320 of A1B8Z0
4mp6A Staphyloferrin b precursor biosynthetic enzyme sbnb bound to citrate and NAD+ (see paper)
20% identity, 72% coverage: 80:298/306 of query aligns to 94:318/334 of 4mp6A
- active site: M236 (≠ R220)
- binding nicotinamide-adenine-dinucleotide: R120 (≠ K106), T121 (= T107), G146 (= G132), L147 (≠ T133), I148 (≠ V134), D170 (≠ N155), Q171 (≠ R156), C211 (= C190), T212 (= T191), V213 (≠ M192), I233 (= I212), G306 (= G286)
Sites not aligning to the query:
1x7dA Crystal structure analysis of ornithine cyclodeaminase complexed with NAD and ornithine to 1.6 angstroms (see paper)
27% identity, 48% coverage: 90:235/306 of query aligns to 95:247/340 of 1x7dA
- active site: D227 (≠ Y215)
- binding nicotinamide-adenine-dinucleotide: R111 (≠ K106), T112 (= T107), G137 (= G132), A138 (≠ T133), Q139 (≠ V134), D160 (≠ N155), T161 (≠ R156), V200 (≠ C190), T201 (= T191), A202 (vs. gap), I209 (≠ V197), V224 (≠ I212), G225 (= G213), D227 (≠ Y215), K231 (≠ M219)
- binding L-ornithine: R111 (≠ K106), D227 (≠ Y215)
Sites not aligning to the query:
- active site: 55
- binding nicotinamide-adenine-dinucleotide: 83, 292, 293, 294
- binding L-ornithine: 44, 53, 55, 57, 68, 70, 71, 72, 293
1u7hA Structure and a proposed mechanism for ornithine cyclodeaminase from pseudomonas putida (see paper)
27% identity, 48% coverage: 90:235/306 of query aligns to 95:247/341 of 1u7hA
- active site: D227 (≠ Y215)
- binding nicotinamide-adenine-dinucleotide: R111 (≠ K106), T112 (= T107), G137 (= G132), A138 (≠ T133), Q139 (≠ V134), D160 (≠ N155), T161 (≠ R156), V200 (≠ C190), T201 (= T191), A202 (vs. gap), I209 (≠ V197), V224 (≠ I212), G225 (= G213), D227 (≠ Y215), K231 (≠ M219)
Sites not aligning to the query:
Q88H32 Ornithine cyclodeaminase; OCD; EC 4.3.1.12 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
27% identity, 48% coverage: 90:235/306 of query aligns to 96:248/350 of Q88H32
Sites not aligning to the query:
- 45 binding
- 69 binding
- 84 binding
- 293 binding
- 294 binding
- 331 binding
4mpdA Staphyloferrin b precursor biosynthetic enzyme sbnb bound a- ketoglutarate and NAD+ (see paper)
21% identity, 72% coverage: 80:298/306 of query aligns to 82:302/318 of 4mpdA
Sites not aligning to the query:
Query Sequence
>GFF3114 FitnessBrowser__Phaeo:GFF3114
MNAILQIPFDQGEANLDWLSFCDALAAGHQLPRAEVADSFLYRDNDTLLNRAAWIDGLGL
AVKSATIFPGNPDQGHPMVNGAVCLYADQSGMLEALVDFHLVTKWKTAGDSLLGALRLAN
PDSREVLIVGAGTVGASLIEAFGTAYPKAQIRIWNRTAEKAEALAEQYPNAKVAADLEAA
VQAADIILTCTMSSTPVIKGAWLRPGQHLNLIGAYRPDMRETDNEALQRADIYCDSFETT
VDHIGEFKIPLSEGVISRDDVRADFYNLTAFPRFDPTRITLFKNGGGAHMDLMTSRHILD
CWQGGT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory