SitesBLAST
Comparing GFF3147 FitnessBrowser__Phaeo:GFF3147 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6b9uA Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from brucella melitensis complexed with nadh
51% identity, 99% coverage: 3:253/253 of query aligns to 2:244/244 of 6b9uA
- active site: G15 (= G16), S142 (= S144), L152 (= L154), Y155 (= Y157), K159 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G12), S14 (= S15), G15 (= G16), F16 (= F17), D35 (= D36), R36 (≠ I37), A57 (≠ V63), D58 (= D64), I59 (≠ V65), N85 (= N91), A86 (= A92), V140 (= V142), S142 (= S144), Y155 (= Y157), K159 (= K161), A187 (= A189), G188 (= G190), T190 (= T192), P191 (= P193), L192 (= L194), F196 (= F198)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
41% identity, 98% coverage: 2:250/253 of query aligns to 7:249/258 of 4wecA
- active site: G21 (= G16), S143 (= S144), Q154 (≠ N153), Y157 (= Y157), K161 (= K161)
- binding nicotinamide-adenine-dinucleotide: G17 (= G12), A19 (= A14), S20 (= S15), G21 (= G16), I22 (≠ F17), D41 (= D36), I42 (= I37), V61 (= V63), D62 (= D64), V63 (= V65), N89 (= N91), T141 (≠ V142), Y157 (= Y157), K161 (= K161), P187 (= P187), P189 (≠ A189), V190 (≠ G190)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
36% identity, 96% coverage: 6:249/253 of query aligns to 3:245/250 of 2cfcA
- active site: G13 (= G16), S142 (= S144), Y155 (= Y157), K159 (= K161)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ R151), R152 (≠ L154), Y155 (= Y157), W195 (≠ T197), R196 (≠ F198)
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), S12 (= S15), G13 (= G16), N14 (≠ F17), D33 (= D36), L34 (≠ I37), A59 (≠ V63), D60 (= D64), V61 (= V65), N87 (= N91), A88 (= A92), G89 (= G93), I140 (≠ V142), P185 (= P187), G186 (≠ V188), M187 (≠ A189), I188 (≠ G190), T190 (= T192), P191 (= P193), M192 (≠ L194), T193 (≠ L195)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
36% identity, 96% coverage: 6:249/253 of query aligns to 3:245/250 of Q56840
- SGN 12:14 (≠ SGF 15:17) binding
- D33 (= D36) binding
- DV 60:61 (= DV 64:65) binding
- N87 (= N91) binding
- S142 (= S144) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (≠ L154) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y157) mutation Y->E,F: Loss of activity.
- K159 (= K161) mutation to A: Loss of activity.
- R179 (= R181) mutation to A: Loss of activity.
- IETPM 188:192 (≠ GETPL 190:194) binding
- WR 195:196 (≠ TF 197:198) binding
- R196 (≠ F198) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (= R207) mutation to A: Slight decrease in catalytic efficiency.
- R209 (≠ T213) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4nbuB Crystal structure of fabg from bacillus sp (see paper)
38% identity, 98% coverage: 2:250/253 of query aligns to 4:241/244 of 4nbuB
- active site: G18 (= G16), N111 (= N116), S139 (= S144), Q149 (≠ L154), Y152 (= Y157), K156 (= K161)
- binding acetoacetyl-coenzyme a: D93 (≠ P98), K98 (≠ D103), S139 (= S144), N146 (≠ R151), V147 (≠ P152), Q149 (≠ L154), Y152 (= Y157), F184 (≠ A189), M189 (≠ L194), K200 (= K209)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ S15), G18 (= G16), I19 (≠ F17), D38 (= D36), F39 (≠ I37), V59 (= V63), D60 (= D64), V61 (= V65), N87 (= N91), A88 (= A92), G89 (= G93), I90 (≠ V94), T137 (≠ V142), S139 (= S144), Y152 (= Y157), K156 (= K161), P182 (= P187), F184 (≠ A189), T185 (≠ G190), T187 (= T192), M189 (≠ L194)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
38% identity, 99% coverage: 1:250/253 of query aligns to 1:247/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), Q15 (≠ S15), G16 (= G16), I17 (≠ F17), D36 (= D36), V63 (= V65), N89 (= N91), A91 (≠ G93), S94 (= S95), I142 (≠ V142), S143 (≠ A143), S144 (= S144), Y157 (= Y157), K161 (= K161), P187 (= P187), H188 (≠ V188), I190 (≠ G190), I194 (≠ L194)
1ahiA 7 alpha-hydroxysteroid dehydrogenase complexed with nadh and 7-oxo glycochenodeoxycholic acid (see paper)
38% identity, 99% coverage: 1:250/253 of query aligns to 7:249/255 of 1ahiA
- active site: G22 (= G16), S146 (= S144), M156 (≠ L154), Y159 (= Y157), K163 (= K161)
- binding glycochenodeoxycholic acid: S146 (= S144), A148 (= A146), N151 (≠ S149), Y159 (= Y157), A196 (≠ L194), V200 (≠ F198)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G18 (= G12), A21 (≠ S15), G22 (= G16), I23 (≠ F17), D42 (= D36), I43 (= I37), D68 (= D64), I69 (≠ V65), N95 (= N91), Y159 (= Y157), K163 (= K161), P189 (= P187), G190 (≠ V188), I192 (≠ G190), T194 (= T192), A196 (≠ L194)
Sites not aligning to the query:
P0AET8 7alpha-hydroxysteroid dehydrogenase; 7alpha-HSDH; NAD-dependent 7alpha-hydroxysteroid dehydrogenase; EC 1.1.1.159 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 99% coverage: 1:250/253 of query aligns to 7:249/255 of P0AET8
- I23 (≠ F17) binding
- DI 42:43 (= DI 36:37) binding
- DI 68:69 (≠ DV 64:65) binding
- N95 (= N91) binding
- G99 (≠ S95) binding
- S146 (= S144) binding ; mutation S->A,H: Reduction of the catalytic efficiency by over 65%. No effect on the affinity for cholate and NAD.
- N151 (≠ S149) binding
- Y159 (= Y157) binding ; binding ; mutation to F: Loss of activity.; mutation to H: Reduction of the catalytic efficiency by 87.7%. No effect on the affinity for cholate and NAD.
- K163 (= K161) binding ; mutation to I: Reduction of the catalytic efficiency by 95%. No effect on the affinity for cholate and NAD.; mutation to R: Reduction of the catalytic efficiency by 35%. No effect on the affinity for cholate and NAD.
- ILT 192:194 (≠ GET 190:192) binding
1ahhA 7 alpha-hydroxysteroid dehydrogenase complexed with NAD+ (see paper)
38% identity, 99% coverage: 1:250/253 of query aligns to 7:249/253 of 1ahhA
- active site: G22 (= G16), S146 (= S144), M156 (≠ L154), Y159 (= Y157), K163 (= K161)
- binding nicotinamide-adenine-dinucleotide: G18 (= G12), A21 (≠ S15), D42 (= D36), I43 (= I37), C67 (≠ V63), D68 (= D64), I69 (≠ V65), N95 (= N91), G97 (= G93), T145 (≠ A143), Y159 (= Y157), K163 (= K161), P189 (= P187), G190 (≠ V188), I192 (≠ G190)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
33% identity, 99% coverage: 1:250/253 of query aligns to 3:251/255 of 5itvA
- active site: G18 (= G16), S141 (= S144), Y154 (= Y157), K158 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), S17 (= S15), G18 (= G16), I19 (≠ F17), D38 (= D36), I39 (= I37), T61 (≠ V63), I63 (≠ V65), N89 (= N91), G91 (= G93), T139 (≠ V142), S141 (= S144), Y154 (= Y157), K158 (= K161), P184 (= P187), G185 (≠ V188), I186 (≠ A189), I187 (≠ G190)
1iy8A Crystal structure of levodione reductase (see paper)
33% identity, 99% coverage: 2:252/253 of query aligns to 1:255/258 of 1iy8A
- active site: G15 (= G16), S143 (= S144), Q153 (≠ L154), Y156 (= Y157), K160 (= K161)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), S14 (= S15), G15 (= G16), L16 (≠ F17), D35 (= D36), V36 (≠ I37), A62 (vs. gap), D63 (= D64), V64 (= V65), N90 (= N91), G92 (= G93), I93 (≠ V94), T141 (≠ V142), S143 (= S144), Y156 (= Y157), K160 (= K161), P186 (= P187), G187 (≠ V188), T191 (= T192), P192 (= P193), M193 (≠ L194)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
33% identity, 99% coverage: 2:252/253 of query aligns to 10:264/267 of Q9LBG2
- 17:42 (vs. 9:34, 35% identical) binding
- E103 (≠ S95) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
35% identity, 100% coverage: 1:253/253 of query aligns to 1:245/248 of Q9KJF1
- M1 (= M1) modified: Initiator methionine, Removed
- S15 (= S15) binding
- D36 (= D36) binding
- D62 (= D64) binding
- I63 (≠ V65) binding
- N89 (= N91) binding
- Y153 (= Y157) binding
- K157 (= K161) binding
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
35% identity, 98% coverage: 6:253/253 of query aligns to 5:244/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), M16 (≠ F17), D35 (= D36), I36 (= I37), I62 (≠ V65), N88 (= N91), G90 (= G93), I138 (≠ V142), S140 (= S144), Y152 (= Y157), K156 (= K161), I185 (≠ L195)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
35% identity, 98% coverage: 3:250/253 of query aligns to 11:255/267 of 3ay6B
- active site: G24 (= G16), S151 (= S144), Y164 (= Y157), K168 (= K161)
- binding beta-D-glucopyranose: E102 (≠ S95), S151 (= S144), H153 (≠ A146), W158 (≠ R151), Y164 (= Y157), N202 (≠ L195), K205 (≠ F198)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G12), T23 (≠ S15), G24 (= G16), L25 (≠ F17), Y45 (≠ I37), D71 (= D64), V72 (= V65), N98 (= N91), A99 (= A92), G100 (= G93), V101 (= V94), M149 (≠ V142), S151 (= S144), Y164 (= Y157), K168 (= K161), P194 (= P187), G195 (≠ V188), M197 (≠ G190), T199 (= T192), P200 (= P193), I201 (≠ L194), N202 (≠ L195)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
34% identity, 98% coverage: 3:250/253 of query aligns to 5:249/261 of 1g6kA
- active site: G18 (= G16), S145 (= S144), Y158 (= Y157), K162 (= K161)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ S15), G18 (= G16), L19 (≠ F17), R39 (≠ I37), D65 (= D64), V66 (= V65), N92 (= N91), A93 (= A92), G94 (= G93), M143 (≠ V142), S145 (= S144), Y158 (= Y157), P188 (= P187), G189 (≠ V188), I191 (≠ G190), T193 (= T192)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
34% identity, 98% coverage: 3:250/253 of query aligns to 5:249/261 of P40288
- 11:35 (vs. 9:33, 36% identical) binding
- E96 (≠ S95) mutation E->A,G,K: Heat stable.
- D108 (= D108) mutation to N: Heat stable.
- V112 (= V112) mutation to A: Heat stable.
- E133 (≠ K132) mutation to K: Heat stable.
- V183 (= V182) mutation to I: Heat stable.
- P194 (= P193) mutation to Q: Heat stable.
- E210 (≠ L211) mutation to K: Heat stable.
- Y217 (≠ R218) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
5yssB Crystal structure of aminocaproic acid cyclase in complex with NAD (+) (see paper)
35% identity, 98% coverage: 3:250/253 of query aligns to 2:251/255 of 5yssB
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), T13 (≠ A14), S14 (= S15), G15 (= G16), I16 (≠ F17), G35 (≠ A39), F36 (≠ D40), L60 (≠ V65), N86 (= N91), G88 (= G93), I89 (≠ V94), A137 (= A143), Y151 (= Y157), K155 (= K161), P181 (= P187), G182 (≠ V188), V184 (≠ G190), T186 (= T192)
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
34% identity, 99% coverage: 1:250/253 of query aligns to 1:240/251 of H9XP47
- N15 (≠ S15) binding
- M17 (≠ F17) binding
- D36 (= D36) binding
- D60 (= D64) binding
- V61 (= V65) binding
- N87 (= N91) binding
- S138 (= S144) binding ; binding
- V139 (≠ T145) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (≠ A146) binding
- Y151 (= Y157) binding ; binding ; binding
- K155 (= K161) binding
- V184 (≠ L195) binding
- T186 (= T197) binding
- RDK 197:199 (≠ RAK 207:209) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
35% identity, 99% coverage: 1:250/253 of query aligns to 1:244/247 of 4jroC
- active site: G16 (= G16), S142 (= S144), Q152 (≠ L154), Y155 (= Y157), K159 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ A14), R15 (≠ S15), G16 (= G16), I17 (≠ F17), N35 (≠ A35), Y36 (≠ D36), N37 (≠ I37), G38 (≠ N38), S39 (≠ A39), N63 (≠ D64), V64 (= V65), N90 (= N91), A91 (= A92), I93 (≠ V94), I113 (≠ V115), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), I188 (≠ L195), T190 (= T197)
Query Sequence
>GFF3147 FitnessBrowser__Phaeo:GFF3147
MRLAGKCAIVTGGASGFGAGIVTKFLTEGARVMIADINADAAAAAASDVCETYGPDRAIA
QTVDVSDRASVDQMAQAALNHFGQIDILVNNAGVSHLPTPLEDVSEEDFDRVVAVNMKSV
YLTARALVPHMKSRQSGAILNVASTAGVSPRPNLNWYNASKGWMITATRTMAVELAPAGV
RVNAINPVAGETPLLKTFMGEDTPEVRAKFLSTIPIGRFSTPEDMGNAACYLCSDEASMV
TGVALEVDGGRCI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory